KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_3818Help
Entry
EC958_3818        CDS       T04373                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00564  Glycerophospholipid metabolism
ecos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EC958_3818 (glpD)
Enzymes [BR:ecos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EC958_3818 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: CDN84163
UniProt: W8ZXH7
LinkDB All DBs
Structure
PDB: 

Position
3849459..3850979
Genome map
AA seq 506 aa AA seqDB search
MNEGSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRY
LEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRT
SLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSA
RRENGLWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIV
VPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKV
YNTHFKKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKL
TTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLAR
HYARTYGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGM
WLNADQQSRVSQWLMEYTQQRLSLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagggcagcatggaaaccaaagatctgattgtgataggtggcggcatcaatggt
gctggtatcgcggcagacgccgctggacgcggtttatccgtgctgatgctggaggcgcag
gatctcgcttgcgcgacctcttccgccagttcaaaactcattcacggtggcctgcgctac
cttgagcactatgaattccgactggtcagcgaggcgctggctgaacgtgaagtgctactg
aaaatggccccgcatatcgccttcccgatgcgttttcgcctgccgcatcgtccgcatcta
cgcccggcgtggatgattcgcattggtctgtttatgtacgatcatctgggcaagcgcacc
agcctgccgggatcaaccggtttgcgttttggcgcaaactcagtgttaaaaccggaaatt
aagcgcggattcgaatattctgactgttgggtagacgacgcccgtctggtactcgccaac
gcccagatggtggtacgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgct
cgccgcgaaaacggcctgtggattgtggaagcggaagatatcgataccggcaaaaaatat
acatggcaggcgcgcggcctggttaatgctaccggcccgtgggtgaaacaatttttcgac
gacgggatgcatctgccttcgccttatggcattcgcctgatcaaaggcagccatattgtg
gtgccgcgtgtgcatacccagaagcaagcctacattctgcaaaacgaagataaacgtatt
gtcttcgtgatcccgtggatggacgagttttccatcatcggcaccaccgatgtggaatac
aaaggcgatccaaaagcagtgaagattgaagagagtgaaatcaattacctgttgaaagtg
tataacacgcactttaaaaagcagttaagccgggacgatatcgtctggacctactccggc
gtgcgtccgctatgtgatgatgagtccgactcgccgcaggccattacccgtgattacacc
cttgatatccatgatgaaaacggcaaagccccgctgctgtcggtattcggcggtaagctg
accacctaccgcaaactggcggagcacgcgctggaaaaactgacgccatattatcagggc
attggtccggcgtggacgaaagagagcgtgctgccgggtggtgccattgaaggtgaccgt
gacgattacgccgcccgcctgcgccgccgttacccgttcctgaccgaatcgctggcacgt
cactacgcgcgcacttacggcagcaacagcgaactgttgctcggcaatgcaggggcgata
agcgacctcggtgaagatttcggtcatgagttctacgaagcggagctgaaatatctggtc
gaccacgaatgggtccgccgcgccgacgatgccctgtggcgtcgcacgaaacaaggcatg
tggctaaatgcggatcaacaatctcgtgtgagtcagtggctgatggaatatacgcagcag
aggttgtcgctggcgtcgtaa

DBGET integrated database retrieval system