KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_3921Help
Entry
EC958_3921        CDS       T04373                                 

Gene name
gadA
Definition
(GenBank) glutamate decarboxylase alpha
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00250  Alanine, aspartate and glutamate metabolism
ecos00410  beta-Alanine metabolism
ecos00430  Taurine and hypotaurine metabolism
ecos00650  Butanoate metabolism
ecos01100  Metabolic pathways
ecos01110  Biosynthesis of secondary metabolites
ecos01120  Microbial metabolism in diverse environments
ecos02024  Quorum sensing
Module
ecos_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EC958_3921 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC958_3921 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EC958_3921 (gadA)
   00430 Taurine and hypotaurine metabolism
    EC958_3921 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EC958_3921 (gadA)
Enzymes [BR:ecos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EC958_3921 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CDN84269
UniProt: W8ZQD9
LinkDB All DBs
Structure
PDB: 

Position
complement(3956923..3958386)
Genome map
AA seq 487 aa AA seqDB search
MLPLRINPTFLLPSNKFKEFEMDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRD
DVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLR
CVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVC
GPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEF
PQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGL
APLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGY
TKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERL
RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQ
QNSFKHT
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgcttccattgcggataaatcctacttttttattgccttcaaataaatttaaggagttc
gaaatggaccagaagctgttaacggatttccgctcagaactactcgattcacgttttggt
gcaaaggccatttctactatcgcggagtcaaaacgatttccgctgcacgaaatgcgcgat
gatgttgcatttcagattatcaatgatgaattatatcttgatggcaacgctcgtcagaac
ctggccactttctgccagacctgggacgacgaaaacgtccataaattgatggatttgtcg
atcaataaaaactggatcgacaaagaagaatatccgcaatctgcagcaatcgacctgcgt
tgcgtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcaggccgtt
ggcaccaacaccattggctcttccgaggcctgtatgctcggcgggatggcgatgaaatgg
cgttggcgcaagcgtatggaagccgcaggcaaacccacggataaaccaaacctggtgtgc
ggtccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttgcgtgag
atccctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgac
gaaaacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttc
ccgcagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgac
atgcacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtc
tgggacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctg
gctccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactg
gtgttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttctcccgc
ccggcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaaggctat
accaaagtacagaacgcttcctaccaggttgccgcttatctggcggatgaaatcgccaaa
ctggggccgtatgagttcatctgtaccggtcgcccggacgaaggcatcccggcggtttgc
ttcaaactgaaagatggtgaagatccaggatacaccctgtacgacctctctgaacgtctg
cgtctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtg
gtgatgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaa
gactacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtattgcccag
cagaacagctttaaacacacctga

DBGET integrated database retrieval system