KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0639Help
Entry
ECP_0639          CDS       T00373                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECP_0639
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECP_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C Glutaredoxin FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: ABG68667
UniProt: A0A454A261
LinkDB All DBs
Structure
PDB: 

Position
675516..677111
Genome map
AA seq 531 aa AA seqDB search
MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
SKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGNIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaaagcccaggagataaacatgctcgacacaaatatgaaaactcaactc
aaggcttaccttgagaaattgaccaagcctgttgagttaattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgttggctgaaatcgcagaactgtcagacaaagtc
acctttaaagaagataacagcttgccggtgcgtaagccgtctttcctgatcaccaaccca
ggttccaaccagggaccacgttttgcaggctccccgctgggccacgagttcacctcgctg
gtactggcgttgctgtggaccggtggtcatccgtcgaaagaagcgcagtctctgctggag
cagattcgccatattgacggtgattttgaattcgaaacctattactcgctctcttgccac
aactgccctgacgtggtgcaggcgctgaacctgatgagcgtactgaacccgcgcatcaag
cacactgcaattgacggcggcaccttccagaacgaaatcaccgatcgcaacgtgatgggc
gttccggcagtgttcgtaaacgggaaagagtttggtcagggccgcatgacgttgactgaa
atcgttgccaaaattgatactggtgcggaaaaacgtgcggcagaagagctgaacaagcgt
gatgcttatgacgtattaatcgttggttccggcccggcgggtgcagcggcagcaatttac
tccgcacgtaaaggcatccgtaccggtctgatgggcgaacgttttggtggtcagatcctc
gataccgttgatatcgaaaactacatttctgtaccgaagaccgaaggccagaaactggca
ggtgcgctgaaagttcatgttgatgaatacgacgttgatgtgatcgacagccagagcgcg
agcaaactgatcccggcagcggttgaaggcggcctgcatcagattgaaacagcttctggc
gcggtactgaaagcacgcagcattatcgtggcgactggtgcaaaatggcgcaacatgaac
gttcctggcgaagatcagtatcgcaccaaaggcgtgacctattgcccgcactgcgacggc
ccgctgtttaaaggcaaacgcgtagcggttatcggcggcggtaactccggcgtggaagcg
gcaattgacctggcgggtatcgttgagcacgtaacgctgctggaatttgcgccagaaatg
aaagccgaccaggttctgcaggacaaactacgcagcctgaaaaacgtcgacattattctg
aatgcgcaaaccacggaagtgaaaggcgacggtagcaaagtcgtaggtctggaatatcgc
gatcgtgtcagcggcaatattcacaacatcgaactggccggtattttcgtccagattggt
ctgctgccgaacaccaactggctggaaggcgcagtcgaacgtaatcgcatgggcgagatt
atcattgatgcgaaatgcgaaaccaacgtcaaaggcgtgttcgcagcgggtgactgtacg
acggttccgtacaagcagatcatcatcgccactggcgaaggtgccaaagcctctctgagt
gcttttgactacctgattcgcaccaaaactgcataa

DBGET integrated database retrieval system