KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2129
Entry
ECP_2129          CDS       T00373                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00052  Galactose metabolism
ecp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECP_2129
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECP_2129
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH Methyltransf_25 UDPG_MGDP_dh_N PrmA ELFV_dehydrog FAD_binding_2 TrkA_N ThiF
Other DBs
NCBI-ProteinID: ABG70128
UniProt: A0A454A5I7
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2212411..2213358)
AA seq 315 aa
MPARAYVVPDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFT
CPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRNNVFALPADMPIEDGAFIEPITVGLH
AFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFN
SREMSAPQIQGVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSA
TFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVR
DIARNAMPGKVLLIP
NT seq 948 nt   +upstreamnt  +downstreamnt
ttgccagctcgggcttatgtggttccggatttacccaggatatttaaaaatggtgcacat
tattatccaataacgttaggccatgaatttagtggctatattgatgcggtgggatccggt
gttgatgatttacaccccggcgatgcggttgcctgtgtgccgttattaccctgttttact
tgtccagagtgtctgaaagggttttattcccagtgcgcaaaatatgattttattggctca
cggcgtgatggtggatttgccgaatatattgtcgttaagcgaaacaatgtctttgcacta
cctgcggatatgcctattgaggatggcgcttttattgaaccgattaccgttggcctgcat
gcttttcatttagcgcaaggatgtgagaataaaaacgttattattattggtgccggaacc
attggcctgctggcaattcagtgcgctgtcgcgctgggagcaaagagtgtgacggctatc
gacattagctcagaaaaactggcactggcaaaatctttcggtgcgatgcaaacatttaac
agccgtgaaatgagcgcgccgcaaatacagggcgttttacgcgagctgcgctttaatcag
cttatcctcgagacggctggcgtcccgcaaaccgtcgaactggcggtagagattgccggt
cctcatgcccaactggcgctggtgggcacgttgcatcaggatctgcatttaacatctgca
acgtttggcaaaatattgcgtaaagagctgacggttatcggcagttggatgaactactcc
agcccttggccggggcaggagtgggaaacggcgagccggttgctgacagaacgtaagtta
agcctggagccattaatcgctcaccgtggaagctttgaaagcttcgcccaggcggtgcgt
gacatcgctcgtaatgccatgccgggcaaagtgttgctcattccctga

DBGET integrated database retrieval system