KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_2625Help
Entry
ECP_2625          CDS       T00373                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00250  Alanine, aspartate and glutamate metabolism
ecp00280  Valine, leucine and isoleucine degradation
ecp00410  beta-Alanine metabolism
ecp00640  Propanoate metabolism
ecp00650  Butanoate metabolism
ecp01100  Metabolic pathways
ecp01120  Microbial metabolism in diverse environments
Module
ecp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECP_2625
   00650 Butanoate metabolism
    ECP_2625
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECP_2625
   00280 Valine, leucine and isoleucine degradation
    ECP_2625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECP_2625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecp01007]
    ECP_2625
Enzymes [BR:ecp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECP_2625
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECP_2625
Amino acid related enzymes [BR:ecp01007]
 Aminotransferase (transaminase)
  Class III
   ECP_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABG70614
LinkDB All DBs
Structure
PDB: 

Position
2768141..2769421
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGHKLKDGLLAIAEKHPEIGDIRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYNNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccaggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgccgccaccaaacgtagcggaactatcgcctttagcggcgcgtaccacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgcctgggcacgtttatcgcgcgctttatccttgcccgctgcacggcatcagtgaa
gatgacgctatcgccagcattcaccgaatttttaaaaatgatgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggcgttgcg
ccggatcttaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtggcagcgctggaagtgttaaaggtattcgagcaggaaaatctg
ctgcaaaaagccaacgacctggggcataagctgaaagacggattgctggcgatagccgaa
aaacacccggagatcggcgatatacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgccaaactcaccgccgagatcgtggcgcgtgcc
cgcgataaaggcctgattcttctctcctgcggcccgtataacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system