KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_3511Help
Entry
ECP_3511          CDS       T00373                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
ecp00564  Glycerophospholipid metabolism
ecp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECP_3511
Enzymes [BR:ecp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECP_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ABG71487
LinkDB All DBs
Structure
PDB: 

Position
3668553..3670058
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAE
QQSRVSQWLVEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgactggtcagcgaggcgctggctgaacgtgaagtgctactgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccgcatcgtccgcatctacgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggcaagcgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggta
cgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatacatggcaggcgcgc
ggcctggttaatgctaccggcccgtgggtgaaacaatttttcgacgacgggatgcatctg
ccttcaccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaagcctacattctgcaaaacgaagataaacgtattgtcttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccaaaa
gcagtgaagattgaagagagtgaaatcaattacctgttgaaagtgtataacacgcacttt
aaaaagcagttaagccgggacgatatcgtctggacctactccggcgtgcgtccgctatgt
gatgatgagtccgactcgccgcaggccattacccgtgattacacccttgatatccatgat
gaaaacggcaaagccccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcagaacatgcgctggaaaaactgacgccgtattatcagggcattggtccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgtgacgattacgccgcc
cgcctgcgccgccgttacccattcctgaccgaatcactggcacgtcactacgcgcgcact
tacggcagcaacagcgaactgctgctcggcaatgcaggggcgataagcgacctcggtgaa
gatttcggtcatgagttctacgaagcggagctgaaatatctggtggatcacgaatgggtc
cgccgcgccgacgatgccctgtggcgtcgcacaaaacaaggcatgtggctgaatgcggaa
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaggttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system