KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_4492Help
Entry
ECP_4492          CDS       T00373                                 

Definition
(GenBank) Mg(2+) transport ATPase, P-type 1
  KO
K01531  P-type Mg2+ transporter [EC:7.2.2.14]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECP_4492
Enzymes [BR:ecp01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.14  P-type Mg2+ transporter
     ECP_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase_N Cation_ATPase_C Cation_ATPase Hydrolase_3 HAD COX7C RskA
Motif
Other DBs
NCBI-ProteinID: ABG72433
UniProt: A0A454AAY6
LinkDB All DBs
Structure
PDB: 

Position
4704503..4707199
Genome map
AA seq 898 aa AA seqDB search
MFKEIFTRFIRHLPSRLVHRDPLPGAQQTVNAAVPPSLSAHCLKMAVMPEEELWKTFDTH
PEGLNLAEVESAREQHGENKLPAQQPSPWWVHLWVCYRNPFNILLTILGAISYATEDLFA
AGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRVINDKGENGWLEIPIDQLV
PGDIIKLAAGDMIPADLRILQARDLFVAQASLTGESLPVEKAATTRQPEHSNPLECDTLC
FMGTTVVSGTAQAMVIATGANTWFGQLAGRVSEQESEPNAFQQGISRVSMLLIRFMLVMA
PVVLLINGYTKGDWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQKVIVKHLDA
IQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKTSERVLHSAWLNSHYQTGLKNLLDTA
VLEGTDEESARSLASRWQKIDEIPFDFERRRMSVVVAENTEHHQLVCKGALQEILNVCSQ
VRHNGEIVPLDDTMLRKIKRVTDTLNRQGLRVVAVATKYLPAREGDYQRADESDLILEGY
IAFLDPPKETTAPALKALKASGITVKILTGDSELVAAKVCHEVGLDAGEVVIGSDIETLS
DDELANLAQRTTLFARLTPMHKERIVTLLKREGHVVGFMGDGINDAPALRAADIGISVDG
AVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFL
PFLPMLPLHLLIQNLLYDVSQVAIPFDNVDDEQIQKPQRWNPADLGRFMVFFGPISSIFD
ILTFCLMWWVFHANTPETQTLFQSGWFVVGLLSQTLIVHMIRTRRVPFIQSCASWPLMIM
TVIVMIVGIALPFSPLASYLQLQALPLSYFPWLVAILAGYMTLTQLVKGFYSRRYGWQ
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaaatttttacccggttcattcgccatttaccttcccgtctggttcatcgt
gatccattgcctggcgcgcagcagacagtgaatgcggcggtcccgccttctttaagtgcg
cattgcctgaaaatggcggtgatgcccgaagaagaattgtggaaaacgttcgacacccat
ccggaagggttaaatctggcggaagtggaatctgcccgcgaacaacatggtgaaaataaa
ttacccgcacaacaaccgtcgccgtggtgggtacatttatgggtctgctatcgcaacccc
tttaatattttgcttaccattctcggtgctatttcttacgccacggaagatttatttgcc
gcaggtgttatcgcgctaatggtcgctatttctacgttgctgaactttattcaggaagct
cgttccaccaaagcggcagatgccctgaaagcgatggtcagtaataccgcgacggtactg
cgcgtaattaacgataaaggtgaaaatggctggctggaaatcccgatagaccaactggtg
cccggcgatattataaaactggcggcgggggatatgatcccggcagatttacgtatcttg
caggcgcgggatctgtttgtcgctcaggcgtcgttaaccggtgagtctctgcccgtagaa
aaagccgctaccactcgccagccggagcacagcaatccgctggagtgcgacaccctgtgt
tttatgggcaccaccgtggtgagcggcacggcacaagcaatggtgattgccacaggtgcc
aatacctggtttggtcaactggcgggtcgtgttagtgagcaggaaagcgagccgaatgcc
tttcagcaagggattagccgcgtcagtatgctgctgattcgctttatgctggtgatggct
ccggtggtgttgcttatcaatggttacactaaaggcgactggtgggaagctgcactgttt
gcgctttcggtcgcggtaggcttaacgccagaaatgttgccgatgattgttacctcgacg
ctggcgcgtggcgcagtcaagttgtcgaaacagaaagtgatcgtcaaacatttggatgcc
attcagaactttggcgcaatggatattctgtgcactgataaaaccggcaccctgacacag
gataaaattgtgctggagaatcataccgatatctccggtaaaactagcgaacgcgtgctg
catagcgcgtggttgaacagccattaccagaccgggcttaaaaacctgcttgataccgcg
gtgctcgaaggtacggatgaagagtcagcgcgctcgctggccagccgttggcaaaaaatt
gatgagattccatttgatttcgagcgtcgtcggatgtcggtggttgtggcagaaaatacc
gaacaccatcagttggtttgcaaaggcgcattgcaggaaatcctcaatgtgtgttcgcaa
gtgcgtcacaatggcgagattgtaccgctcgatgacaccatgctgcgtaagattaagcgg
gttactgatacgctgaatcgtcaggggctgcgcgtggttgcggtggcgacgaaatacctg
ccagcgcgtgaaggagattaccagcgggcggatgaatccgacctgatcctcgaaggatat
attgctttccttgatccgccaaaagagacaaccgctccggcactgaaggcattaaaagcg
agtggaattaccgtaaaaatccttactggcgacagtgagttagttgcagcgaaagtgtgc
catgaagtggggctggacgcgggagaggtggtcattggtagtgatattgaaacgctatct
gacgacgaactggcaaatctcgcacagcgcaccacgctgtttgctcgtctgacgccgatg
cataaagaacgcatcgtaacgttgctgaagcgcgaagggcatgtggttggctttatgggc
gatggtattaatgatgcgcccgccttacgcgctgcggatatcggcatttctgtggacggc
gcggtagatattgcccgtgaagcggctgatatcatcctactggaaaaaagcctgatggtg
ctggaagagggggttattgagggtcgtcgcactttcgccaacatgctgaaatacatcaaa
atgacggcgagctctaacttcggtaatgtgttcagcgtgctggtggcgagtgctttcttg
cccttcctgccgatgttgccgctacacttgcttattcaaaatctgctgtacgatgtgtca
caggtggcgatcccatttgataacgtcgacgacgagcaaattcaaaagccgcagcgttgg
aatccggcggatctggggcgctttatggtcttcttcggaccgatcagctcgattttcgat
attctgacgttttgcctgatgtggtgggtattccatgccaacacgccggaaacgcaaacg
ctgttccagtcgggctggtttgtggtgggcttactgtcgcaaacgctgattgtgcatatg
atccgcacccgccgtgtgccgtttattcagagctgtgcatcgtggccgttaatgatcatg
accgtgatcgtgatgattgtcgggatcgcattgccgttttcaccgctggccagttatctg
caactgcaggcgctgccgttaagctatttcccgtggctggttgcgattctggcagggtat
atgacgttaacccagttggtgaaaggtttctatagccgtcgttacggttggcagtaa

DBGET integrated database retrieval system