KEGG   Escherichia coli O81 ED1a (commensal): ECED1_0169Help
Entry
ECED1_0169        CDS       T00827                                 

Gene name
cdaR
Definition
(GenBank) DNA-binding transcriptional activator
  KO
K02647  carbohydrate diacid regulator
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecq03000]
    ECED1_0169 (cdaR)
Transcription factors [BR:ecq03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    ECED1_0169 (cdaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: CAR06389
UniProt: B7MP24
LinkDB All DBs
Position
188254..189411
Genome map
AA seq 385 aa AA seqDB search
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQPRVVAIVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQLITRMKE
YGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPESRCYFYQDLMLPVLLDSLRG
DWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVALQLDEER
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcatcttgataccaaaatggcgcaggatatcgtggcacgtaccatgcgc
atcatcgataccaatatcaacgtaatggatgcccgcgggcgaattatcggcagcggcgat
cgtgagcgtattggtgaattgcacgaaggagcattgctggtactttcacaaggacgagtc
gtcgatatcgatgacgcggtggcacgtcatctgcacggtgtgcggcaggggattaatcta
ccgttacggctggaaggtgaaattgtcggcgtaattggcctgacaggtgaaccagagaat
ctgcgtaaatatggcgaactggtctgcatgacggctgaaatgatgctggaacagtcgcgg
ttgatgcacctgttggcgcaggatagccgtttgcgggaagaactggtgatgaacctcatt
caggctgaggagaatactcccgcacttactgaatgggcgcaacggctggggatcgatctc
aatcaaccgcgagtggtggctattgttgaggtcgacagcggtcagcttggcgtggacagc
gcaatggcggagttacagcaactgcaaaatgcgctgactacgcccgagcgtaataatctg
gtggcgattgtctcgctaaccgaaatggtggtgttgaaaccggcgttgaactcttttggg
cgctgggacgcagaagatcatcgtaagcgagttgaacaactgattacccgcatgaaagag
tatggccagttgcgttttcgcgtttcgctgggcaactattttaccggtcctggcagtatt
gcccgatcctatcgtacggcgaaaacgacgatggtggtggggaaacagcggatgccagaa
agtcgctgctatttttatcaggatctgatgttacctgtgttactcgacagtttgcgtggc
gactggcaggccaacgaactggcgcgaccgctggcgcggctgaaagcgatggacaataac
ggcttgctgcggcgaacgctggcggcgtggtttcgccacaatgtgcaaccgctggcaacg
tcaaaggcgttgtttattcatcgtaatactctggaatatcggcttaatcgtatatcggaa
ctgaccgggcttgatttgggcaattttgatgacaggttgctgctgtatgtggcgttacaa
ctggatgaagagcggtag

DBGET integrated database retrieval system