KEGG   Escherichia coli O81 ED1a (commensal): ECED1_1855Help
Entry
ECED1_1855        CDS       T00827                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
Enzymes [BR:ecq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECED1_1855 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAR08048
UniProt: B7MVD2
LinkDB All DBs
Structure
PDB: 

Position
1812886..1813467
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattacctgcactaccatatgctaaagatgctctggcaccgcacatttct
gcggaaaccatcgagtatcactacggcaagcatcatcagacttatgtcactaacctgaac
aacctgatcaaaggtaccgcgtttgaaggtaaatcactggaagagattattcgcagctct
gaaggtggcgtattcaacaacgcagctcaggtctggaaccatactttctactggaactgc
ctggcaccgaacgcgggtggcgaaccgactggaaaagtcgctgaagctatcgccgcatct
tttggcagctttgccgatttcaaagctcagtttactgatgcagcgatcaaaaactttggt
tctggctggacctggctggtgaaaaacagcgatggcaaactggctatcgtttcaacctct
aacgcgggtactccactgaccaccgatgcgactccgctgctgaccgttgatgtctgggaa
cacgcttattacatcgactatcgcaatgcacgtcctggctatctggagcacttctgggcg
ctggtgaactgggaattcgtagcgaaaaatctcgctgcataa

DBGET integrated database retrieval system