KEGG   Escherichia coli O81 ED1a (commensal): ECED1_3578
Entry
ECED1_3578        CDS       T00827                                 

Definition
(GenBank) putative Lytic transglycosylase, catalytic precursor
Organism
ecq  Escherichia coli O81 ED1a (commensal)
SSDB
Motif
Pfam: SLT DUF3404 Glucosaminidase
Other DBs
NCBI-ProteinID: CAR09584
UniProt: B7MZR6
LinkDB
Position
complement(3501423..3502085)
AA seq 220 aa
MARGSLLTMALLSMAVSSFCRAGEHDIPEGYVRVAAVHGVPAEVLYAVSLTETVMAPSAI
AGVMKKRDADFRLPSVARPWPWTINVAGKGYRYASRLEAWQALQVFLTRYPARRIDVGIA
QVNLGWNGHRFSSTWAAFDPYISLNTAATILSECRRRHPVSWLQAAGCYHHPAGGAPAVR
YTAVVRQHIERLHRDAVKTAEQHDGLTAMHPRYIWTEPRE
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgcgtggcagccttctgacaatggcgctgttgagcatggctgtcagcagtttctgc
cgggcgggggagcatgatatccctgaggggtatgtgcgcgtggctgccgtgcatggtgtg
cctgcagaagtgctctatgccgtctctctgacagagacggtgatggcgccctctgcgatt
gccggtgtgatgaaaaaacgggatgcggatttccgcctcccgtccgttgcacgtccctgg
ccgtggaccatcaatgtggctggtaagggctaccgctatgccagtcgcctggaagcctgg
caggcacttcaggtttttctgacacggtatccggcccggcggattgacgtgggaattgct
caggtcaatctgggctggaacgggcaccgtttctcctccacatgggcggcatttgatccg
tacatcagtctgaacaccgcggcgaccatcctgagtgaatgccgtcgtcgtcatcctgtc
agctggctgcaggcggccggttgttatcatcatccggcaggtggtgctccggcagtacgc
tacaccgcagtggtcagacaacatattgagcgtcttcatcgtgatgcggtgaagaccgca
gagcagcatgacggcctgaccgccatgcatccccgttatatctggacagaaccccgggag
tga

DBGET integrated database retrieval system