KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4138Help
Entry
ECED1_4138        CDS       T00827                                 

Gene name
yhhF
Definition
(GenBank) putative methyltransferase
  KO
K08316  16S rRNA (guanine966-N2)-methyltransferase [EC:2.1.1.171]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecq03009]
    ECED1_4138 (yhhF)
Enzymes [BR:ecq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.171  16S rRNA (guanine966-N2)-methyltransferase
     ECED1_4138 (yhhF)
Ribosome biogenesis [BR:ecq03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    ECED1_4138 (yhhF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cons_hypoth95 MTS MethyltransfD12 RrnaAD Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: CAR10273
UniProt: B7N1Q3
LinkDB All DBs
Structure
PDB: 

Position
4046516..4047112
Genome map
AA seq 198 aa AA seqDB search
MKKPNHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCF
AGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTP
HNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAG
QVAYRLYQREAQGESDAD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccgaatcattccggcagcggccaaatccgcattattggcgggcagtggcga
ggccgtaaactcccggttcctgatagtccaggtctgcgccccaccaccgaccgcgtacgc
gaaacgttgtttaactggctggctccggtcattgttgacgcccaatgtctggattgcttc
gccgggagcggcgcgctggggctggaagcgttatcgcgctacgctgcgggggccacgttg
attgagatggatcgtgcggtttctcagcagttaattaagaatctggcgacactaaaagca
ggcaatgcacgcgtggtgaacagcaacgcgatgtcattcctggcgcaaaaaggcacaccg
cataatatcgtgtttgtcgatccaccgttccgccgtggcttgttagaagagacgataaat
ttactggaagataacggctggctggctgacgaagccctgatttatgtcgaaagcgaagtc
gaaaacggtctgcccactgttccggcaaactggtcattacatcgggaaaaagtggcgggt
caggtggcttatcggctgtatcaacgcgaagcacaaggagaaagtgatgctgattaa

DBGET integrated database retrieval system