KEGG   Escherichia coli O81 ED1a (commensal): ECED1_4411Help
Entry
ECED1_4411        CDS       T00827                                 

Gene name
bglB
Definition
(GenBank) cryptic phospho-beta-glucosidase B
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq00010  Glycolysis / Gluconeogenesis
ecq00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECED1_4411 (bglB)
   00500 Starch and sucrose metabolism
    ECED1_4411 (bglB)
Enzymes [BR:ecq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECED1_4411 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: CAR10395
UniProt: B7N224
LinkDB All DBs
Position
complement(4339207..4340601)
Genome map
AA seq 464 aa AA seqDB search
MKAFPETFLWGGATAANQMEGAWQEDGKGITTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEAEPNEAGLAFYERLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHAP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLIPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKISEWGWQIDPVGLRILLNTLWDRYQKPLFIV
ENGLGAKDSVEVDGSIQDDYRIAYLNDHLVQVNEAIADGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggtgcaacagctgccaatcagatggaa
ggcgcctggcaggaagatggcaaagggatcacgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaatttttcctcagggcgatgaagccgaaccgaatgaa
gcggggttagcattttacgagcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgggcggtcatcgatcacttcgagcattacgcacgcacggtctttacccgctac
caacataaagttgcgttatggctgacatttaatgaaatcaacatgtcattacacgcgcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggcgatccat
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgatccccgaagcg
aaaattggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggtcagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacataccgtagatttcatctcttttagttattac
atgaccggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatcccaaatccgcatctgaaaatttcagagtgggggtggcaaattgatccggtt
ggattacggattctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagtggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattgccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggtgaaggaagcctc
acaagaacgcgcaagaaaagcttcggatggtatgcagaagtgatcaaaactcgggggcta
tcattaaaaaaataa

DBGET integrated database retrieval system