KEGG   Escherichia coli O81 ED1a (commensal): ECED1_5041Help
Entry
ECED1_5041        CDS       T00827                                 

Gene name
fbpB
Definition
(GenBank) permease component of transport system for ferric iron
  KO
K02011  iron(III) transport system permease protein
Organism
ecq  Escherichia coli O81 ED1a (commensal)
Pathway
ecq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECED1_5041 (fbpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecq02000]
    ECED1_5041 (fbpB)
Transporters [BR:ecq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    ECED1_5041 (fbpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAR11143
UniProt: B7MT67
LinkDB All DBs
Position
complement(4971628..4973763)
Genome map
AA seq 711 aa AA seqDB search
MHLPGAAQTPAPANHTGTAMSQTLALHPAKKRDAIFLWVLLGWLAFILLPSWSLDYGLLE
STSDEILEAYSWSHFNISWLWYLLPSLLLVRPFNEAKREQRSRHYFDAGWALLCIAFMVI
SATIVGRGLGYAAIVLFIELSAIMTLALTRLEWLGGDRFVIGSLIAIVALIGIFIVWPSI
AIFIPMFANDAGEFAPLAFINVLSQAHIIQVIVNSIVLSIAVGIGCTFFGLVLAIYTTRI
AKRSAVIGRIFSILPIVTPPFVVGLGVTLMMGRSGYITEFMVEWFGLTNTNWLYGFTGIW
LAQVLAFTPMAFMILDGAIKTIHPSLEEASYTLRASRWQTFSGVFVPLLKPALANAFLIV
VVQSLADFSNPLVLGGNFDVLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCVQYMW
IGKRSYVTVSGKSYRGDVQPLPVTLVCSVVAILAIWIAFNALLYGSIFYGSFTVNWGVDY
TLTLDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAIFGLLIAWVVVRQQFKGKKTIE
FTTMLCFAVPGTVAGVSYILAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAGLGQID
KSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDTRVAT
AYILNRVEDGEYGVAIAYGSILIVVMLAIIFLFDWLIGEARISRSKAKNQA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
gtgcacttgccgggtgcagcacagacgcctgccccggccaaccataccggaactgctatg
tcacagacacttgcactccatcccgcgaaaaagcgggatgcgattttcctttgggttttg
ctgggctggctggcatttatcctgttgccgagctggagcctcgattatggtctgctggag
tccacgagtgatgagatcctcgaggcgtacagctggtcgcattttaatatcagctggctg
tggtatttactcccgagtttgctgctggttcgcccgtttaatgaggccaaacgcgagcag
cgtagccgtcattattttgatgccggctgggcattgctttgtatagcgtttatggtcatc
agtgccaccatcgttggccgcggtctaggctacgccgccatcgtgctgtttatcgaatta
agcgcgataatgacgctggccttaacccgcctcgaatggctgggtggcgaccgctttgtg
atcggctcgctgattgcgattgtggcgctgattggcatttttatcgtctggccgagcatc
gccatttttatcccgatgttcgccaacgacgcgggagagttcgccccactggcgtttata
aatgtgctctcgcaggcccatatcattcaggtgatcgtcaactctatcgtcttatcgata
gcggtgggtattggctgcactttcttcggtctggtgctggcgatatataccacgcgcatc
gctaaacgcagcgccgtaatcggccgcatcttttccattctgccaattgtcacgccaccg
tttgtggtcggcttaggcgttacgctcatgatggggcgctccggctacataacggaattt
atggtggagtggtttgggctgaccaacaccaactggctgtatggttttaccgggatctgg
ctggcacaggtcctggcatttacgccaatggcttttatgatcctcgatggggccattaaa
accattcatccctcgctggaagaagcctcctacaccctacgcgccagccgctggcaaacc
tttagcggtgtgtttgtgccgttgttaaagcccgcgcttgccaatgcctttttaatcgtc
gtggtgcagtcactggctgacttcagtaacccgctggtgcttggcggcaacttcgacgta
ctggcgacgcaaatttacttctacattaccggctcgcagctggattatcaggccgccagc
acccttggcgctttcctgctgctgttctcgctactggtgttctgcgtccagtatatgtgg
attggtaaacgctcttacgtcacggtttccggaaagtcctaccgcggcgatgtccagcca
ctaccggtcaccctggtgtgtagcgtggtcgccatacttgcgatatggattgcctttaac
gccctgctctatggcagcattttctacggcagcttcaccgtgaactggggcgtggactac
accctgacgctggataactttatcaagttatttggtcaggggatgagcgacggcgcgtgg
ccttcactgttagataccttgctctacgccgggattgccgcacccattaccgctattttt
ggcctgctcatcgcctgggtggtggtgcgccaacaattcaaaggcaaaaagaccatcgag
ttcaccaccatgttgtgctttgccgtaccgggtacagtggcgggtgtctcgtatattctt
gcctttaatagcgccccagtctatctcaccggaacggcagcaattgtgattatctcgatg
gtgatgcgtaacgttccggtgggtattcgcgccgggattgcaggtctggggcagatcgac
aaatcgctggatgaagcctcacttagcctgcgtgcaggttccctgcgaaccattacgcac
attttactgccgttattacgcccagctattctctcggccctgatttacagctttgtgcgg
gctatcacgacggtcagcgccatcgtctttctcgtcacgccggacacccgcgtggcaacc
gcctacatccttaaccgcgtagaagacggcgaatatggcgtagccatcgcctacggttcg
attctgatcgtggtgatgctggcgattattttcctctttgactggctgatcggtgaagca
cgtatttcccgttctaaagccaaaaaccaggcgtaa

DBGET integrated database retrieval system