KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0091Help
Entry
ECIAI1_0091       CDS       T00828                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00473  D-Alanine metabolism
ecr00550  Peptidoglycan biosynthesis
ecr01100  Metabolic pathways
ecr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECIAI1_0091 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECIAI1_0091 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ECIAI1_0091 (ddlB)
Enzymes [BR:ecr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ECIAI1_0091 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ecr01011]
 Precursor biosynthesis
  Amino acid ligase
   ECIAI1_0091 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATPgrasp_YheCD ATPgrasp_ST TTL RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: CAQ96981
LinkDB All DBs
Structure
PDB: 

Position
102640..103560
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIE
KWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQEL
VLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaatcgcggtcctgttgggcgggacttccgctgagcgggaagtttctctg
aattctggcgcagcggtgttagccgggctgcgtgaaggcggtattgatgcgtatcctgtc
gacccgaaagaagtcgacgtgacgcaactgaagtcgatgggttttcagaaagtgtttatc
gcgctacacggtcgcggcggtgaagatggtacgctgcagggcatgctcgagctgatgggc
ttgccttataccggcagcggagtgatggcatctgcgctttcaatggataaactacgcagc
aaactgctgtggcaaggtgccggtttaccggtcgctccgtgggttgcgttaacccgcgca
gagtttgaaaaaggcctgagtgataagcagttagcagaaatttctgctctgggtttgccg
gttatcgttaagccgagccgcgaaggttccagtgtgggaatgtcaaaagtagtagcagaa
aatgctctacaagatgcattaagattggcatttcagcacgatgaagaagtattgattgaa
aaatggctaagtgggccggagttcacggttgcgatactcggtgaagaaattttaccgtca
atacgtattcaaccgtccggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccccgcaggtctggaagcgtcacaagaggccaatttgcaggaatta
gtgctgaaagcatggacgacgttaggttgcaaaggatggggacgtattgacgttatgctg
gacagcgatggacagttttatctgctggaagccaatacctcaccgggtatgaccagccac
agcctggtgccgatggcggcacgtcaggcaggtatgagcttctcgcagttggtagtacga
attctggaactggcggactaa

DBGET integrated database retrieval system