KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0382Help
Entry
ECIAI1_0382       CDS       T00828                                 

Gene name
phoA
Definition
(GenBank) bacterial alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00730  Thiamine metabolism
ecr00790  Folate biosynthesis
ecr01100  Metabolic pathways
ecr02020  Two-component system
Module
ecr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECIAI1_0382 (phoA)
   00790 Folate biosynthesis
    ECIAI1_0382 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECIAI1_0382 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecr04147]
    ECIAI1_0382 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecr00537]
    ECIAI1_0382 (phoA)
Enzymes [BR:ecr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECIAI1_0382 (phoA)
Exosome [BR:ecr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECIAI1_0382 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecr00537]
 Enzymes
  ECIAI1_0382 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: CAQ97255
LinkDB All DBs
Structure
PDB: 

Position
414397..415812
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggtggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtcagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacctctgcttggactg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccacggcaat
atcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccaacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggatttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gatggcaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgtcgcg
ccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagctacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system