KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0697Help
Entry
ECIAI1_0697       CDS       T00828                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00020  Citrate cycle (TCA cycle)
ecr00190  Oxidative phosphorylation
ecr00650  Butanoate metabolism
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
ecr01120  Microbial metabolism in diverse environments
ecr01130  Biosynthesis of antibiotics
ecr01200  Carbon metabolism
Module
ecr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECIAI1_0697 (sdhA)
   00650 Butanoate metabolism
    ECIAI1_0697 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECIAI1_0697 (sdhA)
Enzymes [BR:ecr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECIAI1_0697 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ECIAI1_0697 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: CAQ97565
LinkDB All DBs
Structure
PDB: 

Position
756204..757970
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggtcaaacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtaaaaggttcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtcttgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcagcagctgaccgt
accggtcacgcactgttgcataccctttatcagcagaacctgaaaaaccacaccactatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgt
actgcactgtgcatcgaaactggtgaagtggtttatttcaaagcccgcgctaccgtgctg
gcgactggcggggcagggcgtatttatcagtccaccactaacgcccacattaacactggc
gacggcgtcggcatggctatccgcgcaggcgtaccggtgcaggatatggaaatgtggcag
ttccacccgaccggtattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgacgtggtggcgcgttccatcatgattgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacatgcgaaactgaaactcgaccacctgggtaaa
gaagttctcgaatcccgtctgccgggtattctggaactctcccgtaccttcgctcacgtt
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgacggtgaacgagaaaggcgaagatgtggttgtt
ccgggactgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgtgcagcgggtctgcatctgcaa
gagtctatcgccgaacagggcgcattgcgcgatgccagcgagtctgatgttgaagcatct
ctggatcgtctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgattcgt
aaagcgctgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcacat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
cctgagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system