KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0723Help
Entry
ECIAI1_0723       CDS       T00828                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00010  Glycolysis / Gluconeogenesis
ecr00260  Glycine, serine and threonine metabolism
ecr00680  Methane metabolism
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
ecr01120  Microbial metabolism in diverse environments
ecr01130  Biosynthesis of antibiotics
ecr01200  Carbon metabolism
ecr01230  Biosynthesis of amino acids
Module
ecr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecr_M00002  Glycolysis, core module involving three-carbon compounds
ecr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI1_0723 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECIAI1_0723 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI1_0723 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecr04131]
    ECIAI1_0723 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecr04147]
    ECIAI1_0723 (gpmA)
Enzymes [BR:ecr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECIAI1_0723 (gpmA)
Membrane trafficking [BR:ecr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECIAI1_0723 (gpmA)
Exosome [BR:ecr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECIAI1_0723 (gpmA)
  Exosomal proteins of melanoma cells
   ECIAI1_0723 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: CAQ97590
UniProt: B7M6B8
LinkDB All DBs
Structure
PDB: 

Position
complement(786733..787485)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcagaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtcactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttac
gcgaagctgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctaccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagtgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system