KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_0995Help
Entry
ECIAI1_0995       CDS       T00828                                 

Gene name
fabA
Definition
(GenBank) beta-hydroxydecanoyl thioester dehydrase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00061  Fatty acid biosynthesis
ecr01100  Metabolic pathways
ecr01212  Fatty acid metabolism
Module
ecr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECIAI1_0995 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecr01004]
    ECIAI1_0995 (fabA)
Enzymes [BR:ecr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ECIAI1_0995 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     ECIAI1_0995 (fabA)
Lipid biosynthesis proteins [BR:ecr01004]
 Fatty acid synthase
  Component type
   ECIAI1_0995 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CAQ97859
UniProt: B7M883
LinkDB All DBs
Structure
PDB: 

Position
complement(1068382..1068900)
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagaccttcttgcctctggtcgcggtgaa
ctgtttggcgctaaaggcccgcaattgccagcaccgaacatgctgatgatggaccgtgtg
gtcaaaatgaccgaaacgggtggtaacttcgacaaagggtatgttgaagcagaactggat
atcaatccggatctgtggttcttcggatgccactttattggcgatccggttatgccggga
tgcctgggcctggacgcaatgtggcagctggtagggttctacctcggctggctgggcggc
gaaggtaaaggccgcgcgttgggcgttggcgaagtgaaattcactggtcaggtactgccg
acagcgaaaaaagtgacctaccgtattcactttaaacgcattgttaaccgtcgtctgatt
atgggcctggcggatggcgaagtgctggttgatggtcgtcttatctataccgccagcgac
ctgaaagtcggtctgttccaggatacgtctgccttctga

DBGET integrated database retrieval system