KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1452
Entry
ECIAI1_1452       CDS       T00828                                 

Gene name
yncG
Definition
(GenBank) putative enzyme with similarity with GST
  KO
K11208  GST-like protein
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Brite
KEGG Orthology (KO) [BR:ecr00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ECIAI1_1452 (yncG)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C
Other DBs
NCBI-ProteinID: CAQ98310
LinkDB
Position
1516841..1517458
AA seq 205 aa
MIKVYGVPGWGSTISELMLTLADIPYQFVDVSGFDHEGTSRELLKTLNPLCQIPTLALEN
DEIMTETAAIALMVLDRRPDLAPPVGRAERQQFQRLLVWLVANVYPTFTFADYPERWAPD
APEQLKKNVIEYRKSLYIWLNSQLTAEPYAFGEQLTLVDCYLCTMRTWGPGHEWFQDNAT
NISAIADAVCQLPKLQEVLKRNEII
NT seq 618 nt   +upstreamnt  +downstreamnt
atgattaaggtgtatggcgtacccggatggggctctacaatcagtgagctgatgctaaca
ctggctgatattccttatcagttcgttgatgtcagtggttttgaccacgagggaacttca
cgcgagttattgaaaaccctgaacccgttgtgtcagattccgacactggcgctggaaaat
gacgagattatgacggagacagcggcgattgcattgatggttctcgatcgtcgcccggac
cttgcgccaccggttgggcgcgccgaacgtcagcagtttcaacggctattggtctggctg
gttgctaatgtctatccaacattcactttcgccgattaccctgagcgttgggctcctgac
gcacctgaacagttaaagaagaatgtaattgaatatcgtaaatcgctttatatctggctg
aattcacaattgaccgctgaaccttatgcgtttggtgagcaactaacgctggtggactgt
tatctttgcactatgcgcacatgggggcctgggcatgaatggtttcaggataatgccacg
aatatcagtgcgattgctgatgctgtatgtcagttaccgaaattacaagaagtattaaaa
aggaatgaaattatttga

DBGET integrated database retrieval system