KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_1503Help
Entry
ECIAI1_1503       CDS       T00828                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase B, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
Pathway
ecr00250  Alanine, aspartate and glutamate metabolism
ecr00410  beta-Alanine metabolism
ecr00430  Taurine and hypotaurine metabolism
ecr00650  Butanoate metabolism
ecr01100  Metabolic pathways
ecr01110  Biosynthesis of secondary metabolites
ecr01120  Microbial metabolism in diverse environments
ecr02024  Quorum sensing
Module
ecr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ECIAI1_1503 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECIAI1_1503 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECIAI1_1503 (gadB)
   00430 Taurine and hypotaurine metabolism
    ECIAI1_1503 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ECIAI1_1503 (gadB)
Enzymes [BR:ecr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ECIAI1_1503 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAQ98360
LinkDB All DBs
Structure
PDB: 

Position
complement(1577613..1579013)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgcg
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgacgat
gtcgcattccagattatcaatgacgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaatgtccacaaattgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaatatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccaaacctggtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgtgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacactggtaactatgagttccca
caaccgctgcacgatgcgctggataaattccaggccgataccggtatcgacatcgacatg
cacatcgacgctgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgacgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctgggtggtcaaattggtactttcgccatcaacttctcccgcccg
gcgggtcaggtaattgcacagtactatgaattcctgcgcctcggtcgtgaaggctacacc
aaagtacagaacgcctcttaccaggttgccgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtacgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgatcacccgaaactgcagggtattgcccagcag
aacagctttaaacatacctga

DBGET integrated database retrieval system