KEGG   Escherichia coli O8 IAI1 (commensal): ECIAI1_3760Help
Entry
ECIAI1_3760       CDS       T00828                                 

Gene name
yibF
Definition
(GenBank) putative glutathione S-transferase
Organism
ecr  Escherichia coli O8 IAI1 (commensal)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C GST_N_2 GST_N
Motif
Other DBs
NCBI-ProteinID: CAR00557
LinkDB All DBs
Structure
PDB: 

Position
complement(3830884..3831492)
Genome map
AA seq 202 aa AA seqDB search
MKLVGSYTSPFVRKLSILLLEKGITFEFINELPYNADNGVAQFNPLGKVPVLVTEEGECW
FDSPIIAEYIELMNVAPAMLPRDPLESLRVRKIEALADGIMDAGLVSVREQARPAAQQSE
DELLRQREKINRSLDVLEGYLVDGTLKTDTVNLATIAIACAVGYLNFRRVAPGWCVDRPH
LVKLVENLFSRESFARTEPPKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtcggtagctacaccagcccgtttgtacgcaaactttctattctgttgtta
gaaaagggcataactttcgaatttattaatgaactgccctataacgcggacaacggcgtg
gcgcaatttaacccgttaggaaaagtgccggtgctggtgaccgaagagggcgaatgttgg
tttgattcgccgatcatcgctgaatatattgaattaatgaatgtcgctccggcgatgttg
ccgcgcgatccgctggagtcgttgcgggtgcgcaaaattgaggcactggcggatggcatt
atggatgccgggctggtatcggtgcgtgaacaggcgcgtccagcggcgcagcagtctgaa
gatgaattgttacgccagcgggagaaaatcaaccgcagtctggatgtgctggaaggatat
ctggtcgatggcacactcaaaaccgatacggtcaatctggcgactatcgccattgcctgt
gccgtcggatatctcaatttccgccgcgttgcgccaggttggtgtgtcgaccgcccacac
ttagtcaaactggtcgaaaacctgtttagccgcgaaagttttgctcgcaccgaaccgcca
aaggcttga

DBGET integrated database retrieval system