KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0431Help
Entry
ECs0431           CDS       T00048                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00473  D-Alanine metabolism
ecs00550  Peptidoglycan biosynthesis
ecs01100  Metabolic pathways
ecs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECs0431 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECs0431 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ECs0431 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecs01011]
    ECs0431 (ddl)
Enzymes [BR:ecs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ECs0431 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ecs01011]
 Precursor biosynthesis
  Amino acid ligase
   ECs0431 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-GeneID: 914533
NCBI-ProteinID: NP_308458
UniProt: P0A6J9
LinkDB All DBs
Position
complement(459608..460702)
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttgcgcccttcggcgaccagcctcgcccaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgtttgtaggttctgatgttctggcttcagcagcctgtatggat
aaagatgtcaccaaacgtctgctacgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgctaatcgtcacaacatcagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacaatacgcaattgccgtcgatctggcgttcgagttcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaatccgcaa
gccagcacctgtggcgagatcgtactcaccagcgatttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcgccagaaatcaacgat
aagatccgggcgattgccgttcaggcttatcagacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagagaacgaagtggtgatcaacgagatcaacacactgcct
ggcttcaccaacatcagtatgtatccgaagctgtggcaagccagcggtctgggttacacc
gatctgatcacacgtttgattgagctggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system