KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0433Help
Entry
ECs0433           CDS       T00048                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00730  Thiamine metabolism
ecs00790  Folate biosynthesis
ecs01100  Metabolic pathways
ecs02020  Two-component system
Module
ecs_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECs0433
   00790 Folate biosynthesis
    ECs0433
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECs0433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecs04147]
    ECs0433
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecs00537]
    ECs0433
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECs0433
Exosome [BR:ecs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECs0433
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecs00537]
 Enzymes
  ECs0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-GeneID: 914535
NCBI-ProteinID: NP_308460
UniProt: Q8XEB6
LinkDB All DBs
Structure
PDB: 

Position
461526..462941
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTADQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacggctgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggaaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgccgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccacggtaat
atcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccgacc
ctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcatgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgccaaaaag
gatggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggataccaaagctccgggcctcactcaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgtcgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system