KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs0850
Entry
ECs0850           CDS       T00048                                 

Definition
(RefSeq) hypothetical protein
  KO
K23656  T3SS secreted effector NleD
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs0850
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-GeneID: 917593
NCBI-ProteinID: NP_308877
UniProt: A0A0H3JGR6
LinkDB
Position
928594..929292
AA seq 232 aa
MRPTSLNLVLHQSSRSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRAESQKYSPLLLEEARTVG
LGAFSEEVLSENKFHEEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaaggtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgagcagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaggaggtgctttcagaaaataaattccacgaagagattgggatg
ccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system