KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1206
Entry
ECs1206           CDS       T00048                                 

Definition
(RefSeq) Shiga toxin 2 subunit B
  KO
K11007  shiga toxin subunit B
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs02024  Quorum sensing
ecs05130  Pathogenic Escherichia coli infection
Module
ecs_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECs1206
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs1206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ecs02042]
    ECs1206
Bacterial toxins [BR:ecs02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    ECs1206
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 912579
NCBI-ProteinID: NP_309233
UniProt: A7UQX3
LinkDB
Structure
PDB: 
4M1U 1R4P 3MXG

Position
1267936..1268205
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system