KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1879Help
Entry
ECs1879           CDS       T00048                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00250  Alanine, aspartate and glutamate metabolism
ecs00410  beta-Alanine metabolism
ecs00640  Propanoate metabolism
ecs00650  Butanoate metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
Module
ecs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECs1879
   00650 Butanoate metabolism
    ECs1879
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECs1879
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECs1879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecs01007]
    ECs1879
Enzymes [BR:ecs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECs1879
Amino acid related enzymes [BR:ecs01007]
 Aminotransferase (transaminase)
  Class III
   ECs1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 912688
NCBI-ProteinID: NP_309906
UniProt: Q8X7G8
LinkDB All DBs
Position
1873358..1874623
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERAMQLGQRLTKTLIDAKENVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALR
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgccaccccgcgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgccacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccggacatcgccaccctgat
ctggtcgcggcggtggagcagcagctgcaacagtttacccacaccgcgtatcagattgtg
ccatatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcaccaccggtgcggaagcggtggaaaacgcggtgaaaatc
gcccgcgcccataccggacgccctggcgtgattgcgtttagcggcggcttccacggtcgt
acgtatatgactatggcgttaactggaaaggtcgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtcgcg
gccattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggtattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggcaaactgtttgcgatggatcattacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggtgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggcttggcggcacctacgccgggaat
ccgctggcggtggctgccgcgcacgcggtgctcaacattatcgacaaagagtcactctgt
gagcgcgccatgcagttgggacagcgtctgacgaaaaccctgattgatgccaaagaaaac
gttccggccatcgcggcggtacgtggtctgggctcgatgattgcggcagaatttaacgac
ccgcaaacgggcgagccgtcagccgccattgcgcaaaaaattcagcaacgcgcgctggcg
cagggactgcttctactgacctgtggcgcatacggcaacgtgattcgtttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgaga
gattaa

DBGET integrated database retrieval system