KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2666Help
Entry
ECs2666           CDS       T00048                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00500  Starch and sucrose metabolism
ecs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECs2666
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECs2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-GeneID: 912970
NCBI-ProteinID: NP_310693
UniProt: A0A0H3JG42
LinkDB All DBs
Position
2628677..2630164
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKVQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPNEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRNYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaattggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggtgagtttgatcagaaaggcagcatccctactaaatatggcgataaa
gtacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgcgtt
aatgctgatgaccgtacgcaaattgatgaagaaatcattgaatgcgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcacagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccccaatgaagatggcatttttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggcgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggttttcgtcttgatgcggtcaaacatatt
ccagcctggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggcggagtactggtcgcatgaagttgataagctgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggacgcaactacgacatgacgcagattttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgctctaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcgcattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatttaggagagaattacggcaataaaacctggcgtgat
tttcttgggaaccggcaagagagtgtagtaaccgacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgttagcgtgtgggttatcgaagaggtgctttaa

DBGET integrated database retrieval system