KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3059Help
Entry
ECs3059           CDS       T00048                                 

Definition
(RefSeq) PTS system fructose-specific transporter subunit IIBC
  KO
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00051  Fructose and mannose metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
ecs02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECs3059
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECs3059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecs02000]
    ECs3059
Enzymes [BR:ecs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     ECs3059
Transporters [BR:ecs02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    ECs3059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-GeneID: 916763
NCBI-ProteinID: NP_311086
UniProt: Q8XE91
LinkDB All DBs
Position
complement(2994648..2996339)
Genome map
AA seq 563 aa AA seqDB search
MKTLLIIDANLGQARAYMAKTLLGAAARKAKLEIIDNPNDAEMAIVLGDSIPNDSALNGK
NVWLGDISRAVAHPELFLSEAKGHAKPYTAPVAATAPVAASGPKRVVAVTACPTGVAHTF
MAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDLAKFAGKPM
YRTSTGLALKKTAQELDKAVAEATPYEPAGKAQTATSEGKNESAGAYRHLLTGVSYMLPM
VVAGGLCIALSFAFGIEAFKEPGTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLT
PGLIGGMLAVSTGSGFIGGIIAGFLAGYIAKLISTQLKLPQSMEALKPILIIPLISSLVV
GLAMIYLIGKPVAGILEGLTHWLQTMGTANAVLLGAILGGMMCTDMGGPVNKAAYAFGVG
LLSTQTYGPMAAIMAAGMVPPLAMGLATMVARRKFDKAQQEGGKAALVLGLCFISEGAIP
FAARDPMRVLPCCIVGGALTGAISMAIGAKLMAPHGGLFVLLIPGAITPVLGYLVAIIAG
TLVAGLAYAFLKRPEVDAVAKAA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctgctgattattgacgctaatctcggtcaggcacgcgcctatatggcgaag
accctgctgggcgcggcggcgcgaaaagcaaaactggaaatcatcgacaatccgaacgac
gcagaaatggcgattgttctcggtgattccatcccgaatgacagcgcgctgaacggtaaa
aatgtctggctgggcgatatttcccgggcagttgcgcaccctgagctgttcctgagtgaa
gccaaaggccatgcgaaaccttacactgcgccggtcgctgcgacagcaccggttgccgcc
agcggtccgaaacgcgtagttgcggtgactgcttgcccgactggcgtagcacacaccttt
atggcggctgaagccattgaaaccgaagcgaaaaaacgtggctggtgggtgaaagttgaa
acccgtggttctgttggcgcgggtaatgcaatcactcccgaagaagtagccgcagcggat
ctggtgattgtggcggcagatatcgaagtggatctggcgaaatttgctggtaaaccgatg
tatcgcacctctaccggtctggcgctgaagaaaaccgcgcaggaactggataaagcggtt
gctgaagcaacgccgtatgaaccggcgggcaaagctcaaacggcgacctctgaaggtaag
aacgagagtgcaggcgcataccgtcacttgctgacgggcgtctcttacatgctgccgatg
gtcgttgcaggtggtctgtgtatcgcgctttcttttgcttttggtatcgaagcgtttaaa
gagccgggtacgttggcagcggcgctgatgcagattggtggtggttcagcctttgcgctg
atggtgccggtactggcaggttatattgccttctccattgccgatcgtccgggtctcacg
ccgggtctgattggcggtatgctggcggtcagcaccggttctggcttcattggcggtatt
attgcgggcttcctggctggttacattgcgaagttaatcagtacgcaactgaaactgcca
cagagtatggaggcgctgaaaccgatcctgatcattccgctaatttccagtctggtggtc
ggtctggcgatgatctacctgatcggtaaaccggttgctggcattctcgaagggttgact
cactggctgcagaccatggggactgcgaatgcggttctgctgggggcgatcctcggtggc
atgatgtgtactgacatgggcggtccggtaaataaagcagcgtacgcattcggtgtgggt
ctgctgagtactcaaacctatggcccgatggcggcgattatggcggcaggtatggtgcca
ccgctggcaatgggtctggcaacaatggtggcgcgtcgcaaatttgacaaagcgcagcag
gaaggtggcaaagccgctctggttcttggtctgtgctttatttcggaaggtgcaattcct
tttgctgctcgtgatccgatgcgtgtgctgccgtgttgtatcgttggtggggcgctgact
ggcgcaatctcaatggcgattggtgcgaaactgatggcaccgcacggtggtctgtttgtt
ctgctgatccctggcgctattacgccggtactgggttacctggtagcaattattgccggt
acgctggtggcgggtttggcctatgccttcctgaaacgtccggaagtggacgcagtagcg
aaagccgcgtaa

DBGET integrated database retrieval system