KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3523Help
Entry
ECs3523           CDS       T00048                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00250  Alanine, aspartate and glutamate metabolism
ecs00280  Valine, leucine and isoleucine degradation
ecs00410  beta-Alanine metabolism
ecs00640  Propanoate metabolism
ecs00650  Butanoate metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
Module
ecs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECs3523
   00650 Butanoate metabolism
    ECs3523
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECs3523
   00280 Valine, leucine and isoleucine degradation
    ECs3523
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECs3523
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecs01007]
    ECs3523
Enzymes [BR:ecs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECs3523
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECs3523
Amino acid related enzymes [BR:ecs01007]
 Aminotransferase (transaminase)
  Class III
   ECs3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 914761
NCBI-ProteinID: NP_311550
UniProt: A0A0H3JNA7
LinkDB All DBs
Structure
PDB: 

Position
3514922..3516202
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcaattcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgctgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggc
ctgatgccagggcacgtttatcgcgcgctttatccttgcccactgcacggcatcagtgaa
gatgatgctatcgccagtatccaccgaatttttaaaaatgatgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgcctgcg
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggcttcccactggcgggcgtcacc
gggcgcgccgaagtgatggatgccgtcgctccaggcgggctgggtggcacctatgccggt
aatccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcagaaagccaacgatctggggcagaagttgaaagatggattgttggcgatcgccgaa
aaacaccctgagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcaaagcagtag

DBGET integrated database retrieval system