KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4450Help
Entry
ECs4450           CDS       T00048                                 

Definition
(RefSeq) xylose transporter ATP-binding protein
  KO
K10545  D-xylose transport system ATP-binding protein [EC:7.5.2.10]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECs4450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecs02000]
    ECs4450
Enzymes [BR:ecs01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.10  ABC-type D-xylose transporter
     ECs4450
Transporters [BR:ecs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter
    ECs4450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_15 MCM RsgA_GTPase AAA_16 AAA_30 AAA_33 AAA_22 AAA_25
Motif
Other DBs
NCBI-GeneID: 915612
NCBI-ProteinID: NP_312477
UniProt: Q8XDM1
LinkDB All DBs
Position
4478371..4479912
Genome map
AA seq 513 aa AA seqDB search
MPYLLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYE
GEIIFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMT
LRCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTASLTEQETSV
LLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVG
RELTALYPNEPHTTGDEILRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGR
TETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKN
ITLAALNKFTGGISQLDDAAEQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCL
LLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHE
GKLKANLINHNLTQEQVMEAALRSEHHVEKQSV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccttatctacttgaaatgaagaacattaccaaaaccttcggcagtgtgaaggcgatt
gataacgtcagcttgcggttgaatgctggcgaaatcgtctcactctgtggggaaaatggg
tctggtaaatcaacgctgatgaaagtgctgtgtggtatttatccccatggctcctacgaa
ggcgaaattatttttgcgggagaagagattcaggcgagtcacatccgcgataccgaacgc
aaaggtatcgccatcattcaccaggaattggccctggtgaaagaattgaccgtgctggaa
aatatcttcctgggtaacgaaataacccacaatggcattatggattatgacctgatgacg
ctacgctgtcagaagctgctcgcacaggtcagtttatccatttcacctgatacccgcgtt
ggcgatttagggcttgggcaacaacaactggttgaaattgccaaggcacttaataaacag
gtgcgcttgttaattctcgatgaaccgacagcctcattaactgagcaggaaacgtcggtt
ttactggatattattcgcgatctacaacagcacggtatcgcctgtatttatatttcgcac
aaactcaacgaagtcaaagcgatttccgatacgatttgcgttattcgcgacggacagcac
attggtacgcgtgatgctgccggaatgagtgaagacgatattatcaccatgatggtcggg
cgagagttaaccgcgctttaccctaatgaaccacataccaccggagatgaaatattacgt
attgaacatctgacggcatggcatccggttaatcgtcatattaaacgagttaatgatgtc
tcgttttccctgaaacgtggcgaaatactgggtattgccggactcgttggtgccggacgt
accgagaccattcagtgcctgtttggtgtgtggcccggacaatgggaaggaaaaatttat
attgatggcaaacaggtagatattcgtaactgtcagcaagccatcgcccaggggattgcg
atggtccccgaagacagaaagcgcgacggcatcgttccggtaatggcggttggtaaaaat
attaccctcgccgcactcaataaatttaccggtggcattagccagcttgatgacgcggca
gagcaaaaatgtattctggaatcaatccagcaactcaaagttaaaacgtcgtcccccgac
cttgctattggacgtttgagcggcggcaatcagcaaaaagcgatcctcgctcgctgtctg
ttacttaacccgcgcattctcattcttgatgaacccaccaggggtatcgatattggcgcg
aaatacgagatctacaaattaattaaccaactcgtccagcagggtattgccgttattgtc
atctcttctgaattacctgaagtgctcggccttagcgatcgtgtactagtaatgcatgaa
gggaaactaaaagccaacctgataaatcataacctgactcaggagcaggtgatggaagcc
gcattgaggagcgaacatcatgtcgaaaagcaatccgtctga

DBGET integrated database retrieval system