KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4550Help
Entry
ECs4550           CDS       T00048                                 

Definition
(RefSeq) protein EspF
  KO
K12786  LEE-encoded effector EspF
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Module
ecs_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-GeneID: 915286
NCBI-ProteinID: NP_312577
UniProt: Q7DB85
LinkDB All DBs
Position
complement(4589257..4590003)
Genome map
AA seq 248 aa AA seqDB search
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKP
ARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQA
SGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTGPSGLPPLAQALKDHLA
AYEQSKKG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattagtaacgctgcttctacactagggcggcagcttgtaggtatcgca
agtcgagtgagctctgcggggggaactggattttctgtagcccctcaggccgtgcgtctt
actccggtgaaagttcattcccctttttctccaggctcgtcgaatgttaatgcgagaacg
atttttaatgtgagcagccaggtgacttcatttactccctctcgtccggcaccgccgcca
ccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggcatta
aaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagccc
gcccgtcaggcaccgccgccaccgacaagtggacaggcatccggggcatcccgaccttta
ccgcccattgcacaggcattaaaagagcacttggctgcctatgaaaaatcgaaaggtcct
gaggctttaggttttaagcccgcccgtcaggcaccgccgccaccgacaagtggacaggca
tccggggcatcccgacctttaccgcccattgcacaggcattaaaagagcacttggctgcc
tatgaaaaatcgaaaggtcctgaggctttaggttttaagcccgcccgtcaggcaccaccg
ccaccgacagggcctagtggactaccgccccttgcacaggcattaaaagatcatttagct
gcctatgagcaatcgaagaaagggtaa

DBGET integrated database retrieval system