KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1279Help
Entry
ECIAI39_1279      CDS       T00829                                 

Gene name
ydjJ
Definition
(RefSeq) putative iditol dehydrogenase
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2
Motif
Other DBs
NCBI-GeneID: 7153622
NCBI-ProteinID: YP_002407287
UniProt: A0A0H3MPF7
LinkDB All DBs
Structure
PDB: 

Position
1345128..1346171
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKAGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLTMAEQLGATVVINGAKEDTIARCQQFTEEMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYQDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
atacctgtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggacatgaatgcgccgggacggttgtggctgtgggaagccgtgtgcgcaaa
tttaaagcgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacctaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccc
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcgggttgtatt
ggtttgatgacgttgcaagcatgcaaatgcctgggagctacggatattgccgtcgttgat
gtactggaaaaacgtctgacaatggcggaacagctcggcgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagaaatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtaccgggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacagtattccgctatgccaatcgttatccggtcacg
attgaagctatttcctcagggcgattcgatgtgaaatcgatggtgacacatatttacgat
tatcaggatgtacaacaggcatttgaagagtcggttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system