KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1413Help
Entry
ECIAI39_1413      CDS       T00829                                 

Gene name
slyA
Definition
(RefSeq) transcriptional regulator SlyA
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ect03000]
    ECIAI39_1413 (slyA)
Transcription factors [BR:ect03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    ECIAI39_1413 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 B-block_TFIIIC HTH_20 HxlR HTH_5 HTH_24 TrmB DUF4423 HTH_36 LexA_DNA_bind Replic_Relax GntR RP-C GlnD_UR_UTase RsbU_N DUF2250 Fe_dep_repress
Motif
Other DBs
NCBI-GeneID: 7153577
NCBI-ProteinID: YP_002407418
UniProt: B7NTZ0
LinkDB All DBs
Position
1486420..1486854
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLIKLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtactctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccgctgatc
agcgaaatggaagctgttattaacaaaacccgcgcggaaattttacatggcatctccgca
gaggaactggaacaactgattaagctcatcgcaaaacttgagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system