KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1628Help
Entry
ECIAI39_1628      CDS       T00829                                 

Gene name
rnb
Definition
(RefSeq) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_1628 (rnb)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     ECIAI39_1628 (rnb)
Transfer RNA biogenesis [BR:ect03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    ECIAI39_1628 (rnb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2 PilZ OSR1_C
Motif
Other DBs
NCBI-GeneID: 7151565
NCBI-ProteinID: YP_002407628
UniProt: B7NVR1
LinkDB All DBs
Structure
PDB: 

Position
complement(1697894..1699828)
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
IAVIHSEKERESAEPEELVEPFLTRFVGKVQGKNDRLAIVPDHPLLKDAIPCRAARGLNH
EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVPWWVTLARHNLEKEAPDGVAT
EMLDEGLVREDLTALDFVTIDSASTEDMDDALFAKALPDDKLQLIVAIADPTAWIAEGSK
LDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEF
FAATIESKAKLVYDQVSDWLENTGDWQPESEAIAEQVRLLAQICQRRGEWRHNHALVFKD
RPDYRFILGEKGEVLDIVAEPRRIANRIVEEAMIAANICAARVLRDKLGFGIYNVHMGFD
PANADALAALLKTHGLHVDAEEVLTLDGFCKLRRELDAQPTGFLDSRIRRFQSFAEISTE
PGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATRPQDEITVQMAERRRLNRM
AERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDE
LVCSQENGTVQIKGETVYKVTDVIDVTIAEVRMETRSIIARPVA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggacaacccgctgctagcgcagcttaaacagcaactgcattcccagacgcca
cgcgctgaaggggtggtaaaagccacagaaaaaggctttggcttcctggaagtcgacgcg
caaaaaagttatttcattccgccgccgcagatgaaaaaagtcatgcatggcgaccgaatt
atcgcggtgatccacagtgaaaaagaacgtgaatccgcagagccagaagaactggttgaa
ccgttcctgactcgtttcgtgggtaaagttcagggcaaaaatgaccgtctggccatcgtt
cctgatcatccactcttaaaagacgccattccttgccgcgcagcccgtggcctgaaccac
gagtttaaagaaggcgactgggcggttgccgaaatgcgccgtcatccgctgaaaggcgat
cgttctttctatgctgaactgacacaatacatcacttttggtgacgatcactttgtaccg
tggtgggttacccttgcgcgccataatctggaaaaagaagcaccagacggcgtcgctacc
gaaatgctcgatgaaggtctggttcgtgaagatctgactgcgctggattttgtcaccatc
gacagtgccagcacagaagatatggatgacgcccttttcgctaaggcgttgccggatgac
aaacttcagctgattgtggcgattgccgatccaaccgcgtggattgctgaaggcagcaag
ctggacaaagccgcgaaaattcgcgcattcaccaactatctgcctggcttcaacatccct
atgctgcctcgcgagctttctgacgatctctgctcactgcgcgccaatgaagtccgcccg
gtactggcatgccgcatgacgctctccgctgatggcaccattgaagataatatcgaattc
tttgccgccaccatcgaatccaaagcgaagctggtgtatgaccaggtttctgactggctt
gaaaataccggtgactggcagcctgaaagcgaagcaattgccgaacaagtccgtttgcta
gcgcaaatttgccaacgccgcggcgagtggcgtcataaccacgcactggtgtttaaagat
cgcccggattaccgctttattctcggtgaaaaaggagaagtgctggatatcgtcgccgag
cctcgtcgcattgccaaccgtatcgtcgaagaagcgatgattgccgctaacatttgtgcg
gcccgcgtactgcgcgataagctcggttttggcatctataacgtgcatatgggctttgat
ccggcgaatgccgacgcgctggcagcgttgctgaaaacccacggtctgcatgtcgatgcc
gaagaagtgctcacgctggacggtttctgcaaactgcgtcgtgaactggatgcgcaacca
actggtttcctcgacagccgcattcgtcgcttccagtcatttgctgaaattagcactgaa
cccggtcctcactttggcctcggtctggaagcatacgccacctggacttcgccgatccgt
aaatatggcgacatgatcaaccaccgtctgctgaaagcggttatcaaaggcgaaactgcg
acgcgtccgcaggatgaaatcactgtccaaatggccgagcgtcgccgtctcaaccgaatg
gcagaacgtgatgttggcgactggttatacgcacgcttcctgaaagacaaagccgggacc
gacacccgtttcgcggcggaaattgtcgatatcagccgtggcggcatgcgtgtgcgtttg
gttgataacggcgctatcgcctttattccagcacctttcttacacgctgtgcgcgatgaa
ctggtttgcagccaggaaaacggcaccgtacaaattaaaggtgaaacggtttataaagtg
actgacgttattgacgtcactattgccgaagtccgcatggaaacccgcagcattattgcg
cgcccagtcgcgtaa

DBGET integrated database retrieval system