KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1661Help
Entry
ECIAI39_1661      CDS       T00829                                 

Definition
(RefSeq) hypothetical protein
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 7153502
NCBI-ProteinID: YP_002407661
UniProt: A0A0H3MGQ4
LinkDB All DBs
Position
complement(1733326..1733616)
Genome map
AA seq 96 aa AA seqDB search
METFVLFSSLQPEIRAQETSADNSTIFDLIMRCSFLFNPHNLPGAQRYFITHYINFTNQI
PTVQVSNIYMLNIFTDIKQSCQTITIRVASLNTHYG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggagacattcgttttattttcttctttacaacctgaaatcagggcgcaggaaaccagt
gctgataacagcacgatttttgatttaatcatgagatgttcctttttatttaatccacat
aacctgccaggggcgcagcgttatttcattacccactatatcaacttcactaatcagatc
ccgaccgtgcaggtcagtaatatttatatgctgaatattttcactgacattaaacaatcc
tgtcagacaattaccatccgcgttgcttctttgaatacacattacggatga

DBGET integrated database retrieval system