KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1666Help
Entry
ECIAI39_1666      CDS       T00829                                 

Gene name
ycjR
Definition
(RefSeq) putative isomerase/epimerase
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 7153506
NCBI-ProteinID: YP_002407666
UniProt: A0A0H3MGQ9
LinkDB All DBs
Position
1737650..1738438
Genome map
AA seq 262 aa AA seqDB search
MKIGTQNQAFFPENILEKFRYIKEMGFDSFEIDGKLLVNNIEEVKAAIKETGLPVTTACG
GYDGWIGDFIEERRLNGLKQIERILEALAEVGGKGIVVPAAWGMFTFRLPPMTSPRSLDG
DRKMVSDSLCVLEQAAARTGTVVYLEPLNRYQDHMINTLADARRYIVENDLKHVQIIGDF
YHMNIEEDNLAQALHDNRDLLGHVHIADNHRYQPGSGTLDFHALFEQLRADNYQGYVVYE
GRIRAEDPAQAYRDSLAWLRTC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcacacagaatcaggcgttctttccagaaaacattctggagaaatttcgt
tatatcaaagagatgggcttcgatagttttgagattgacggcaaactgctggtcaacaat
atagaagaagtcaaagcggcaatcaaagaaaccggcttaccggtgaccaccgcctgcggc
ggctatgacggctggattggcgactttatcgaagagcgtcgtcttaatggcttaaagcag
atcgaacgcattctcgaagcgctggcagaagtgggcggtaaaggtatcgtcgttccggct
gcatggggcatgtttacctttcgcttaccgccgatgacctcgccgcgtagcctggacggc
gaccgcaaaatggtgagtgattccctgtgcgtactggaacaggcggccgcacgtaccgga
accgtggtgtacctcgaaccgttaaaccgctatcaggatcacatgatcaacaccctcgcc
gatgctcgtcgttacatcgtcgaaaacgatcttaaacatgtacagattatcggcgatttc
tatcacatgaatatcgaagaagataacctggcgcaggcgctgcatgacaaccgcgacctg
ctcggtcatgtgcatattgccgataaccatcgctatcagccgggcagcggcaccctggat
ttccacgcgctgtttgaacagctgcgcgcggataactatcagggctatgtggtgtacgaa
gggcgtatccgggcagaagatcctgcccaggcgtaccgtgattctttggcctggttgcgt
acctgctaa

DBGET integrated database retrieval system