KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1695Help
Entry
ECIAI39_1695      CDS       T00829                                 

Gene name
ydaO
Definition
(RefSeq) C32 tRNA thiolase
  KO
K14058  tRNA 2-thiocytidine biosynthesis protein TtcA
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_1695 (ydaO)
Transfer RNA biogenesis [BR:ect03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    ECIAI39_1695 (ydaO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 7151089
NCBI-ProteinID: YP_002407693
UniProt: B7NHP6
LinkDB All DBs
Position
complement(1768902..1769837)
Genome map
AA seq 311 aa AA seqDB search
MSKNQEISKKEQYNLNKLQKRLRRNVGEAIADFNMIEEGDRIMVCLSGGKDSYTMLEILR
NLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKT
TCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDG
KHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKRYPGRIE
TMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVNRGDLAFDREEIPLQPAGWQPEEDENQL
DELRLNVVEVK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaatcaagaaattagtaagaaagaacaatacaatctgaacaaattacaaaaa
cgtctgcgtcgtaacgtgggcgaagccattgctgacttcaatatgattgaagaaggcgat
cgcatcatggtttgcctctccgggggtaaagacagctataccatgctggaaattctgcgc
aatttgcagcaaagcgcgccaatcaatttttcgctggtggctgtcaacctcgatcaaaaa
caaccgggcttcccggaacacgttctgcccgagtatcttgaaaagctgggcgttgagtac
aagattgtggaagagaacacttacggtatcgtgaaagagaagattccggagggcaaaacc
acttgctcactgtgttctcgtcttcgtcgcggtatcctttatcgcaccgcaacggaactg
ggagcgacgaagatcgcgcttggtcaccatcgtgacgatatcctgcaaacgctgttctta
aatatgttctacggcggcaagatgaaaggtatgcctccgaaactgatgagcgatgatggc
aaacatatcgtgattcgtccgctggcctactgccgcgagaaagatattcagcgctttgcc
gatgcaaaagcgttcccgattattccgtgcaacctgtgcggttcacagcctaacctgcaa
cgtcaggtgattgctgacatgttgcgtgactgggataaacgttatccggggcgtatcgag
acgatgttcagcgcgatgcagaatgtggtgccatcgcatctgtgcgataccaacctgttc
gatttcaaaggcattacccacggttctgaagtggttaaccggggtgatctggcgtttgat
cgcgaagagatccctctacaaccggcgggctggcagcctgaagaagatgaaaatcagttg
gatgagttacgactgaatgtggttgaagtgaaataa

DBGET integrated database retrieval system