KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1704Help
Entry
ECIAI39_1704      CDS       T00829                                 

Definition
(RefSeq) transposase ORF B (fragment), IS629
  KO
K07497  putative transposase
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    ECIAI39_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 rve_2 DDE_Tnp_IS240
Motif
Other DBs
NCBI-GeneID: 7150533
NCBI-ProteinID: YP_002407702
UniProt: A0A0G2QAD8
LinkDB All DBs
Position
1779612..1780058
Genome map
AA seq 148 aa AA seqDB search
MAFIIDVFAGYIVGWRVSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTQR
LKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRR
LLERLGHTPPAEAEKAYYASIGNDDLAA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttcatcattgatgtgtttgccggatacatcgtggggtggcgggtctcatcgtcc
atggaaacgacattcgtgctggatgcactggagcaggcgttatgggcccgtcgaccgtcc
ggcacggtccatcacagtgataaaggttctcagtatgtatcgctggcctacacacagcgg
cttaaggaagccggattactggcatcaacaggaagtacaggcgactcgtatgacaacgcg
atggcggagagcatcaatggtctttacaaagcggaggtaatacaccgtaagagctggaaa
aaccgtgcagaagtggaactggccacactcacgtgggtggactggtataacaatcgacga
ttgctggaaaggctgggccatactcctccggcagaagcagaaaaagcttattatgcttcc
atcggaaacgatgatctggcagcctga

DBGET integrated database retrieval system