KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_2437Help
Entry
ECIAI39_2437      CDS       T00829                                 

Gene name
yfbQ
Definition
(RefSeq) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00220  Arginine biosynthesis
ect00250  Alanine, aspartate and glutamate metabolism
ect00290  Valine, leucine and isoleucine biosynthesis
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01130  Biosynthesis of antibiotics
ect01210  2-Oxocarboxylic acid metabolism
ect01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECIAI39_2437 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    ECIAI39_2437 (yfbQ)
   00220 Arginine biosynthesis
    ECIAI39_2437 (yfbQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ect01007]
    ECIAI39_2437 (yfbQ)
Enzymes [BR:ect01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ECIAI39_2437 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     ECIAI39_2437 (yfbQ)
Amino acid related enzymes [BR:ect01007]
 Aminotransferase (transaminase)
  Class I
   ECIAI39_2437 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 7151973
NCBI-ProteinID: YP_002408393
UniProt: A0A0H3MMM8
LinkDB All DBs
Structure
PDB: 

Position
2524846..2526063
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttacgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgattcgc
aacctgcctaccgctcaagggtattgcgattccaaagggctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcacctgattacccactatggaccgcggcggtttcgctctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggaccttgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
actggcgcggtatattccaaagagcttttaatggagatagtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactcaattgcgccgctggcacctgatctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggctacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctgggcggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcatgggaattgatcaatgatatt
ccgggcgtttcctgcgtgaaaccgcgcggtgcgctgtacatgttcccgaaaatcgacgcc
aaacgctttaatattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system