KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_2613Help
Entry
ECIAI39_2613      CDS       T00829                                 

Gene name
ypfI
Definition
(RefSeq) putative hydrolase
  KO
K06957  tRNA(Met) cytidine acetyltransferase [EC:2.3.1.193]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_2613 (ypfI)
Enzymes [BR:ect01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.193  tRNAMet cytidine acetyltransferase
     ECIAI39_2613 (ypfI)
Transfer RNA biogenesis [BR:ect03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ECIAI39_2613 (ypfI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_RecD tRNA_bind_3 GNAT_acetyltr_2 AAA_30 DUF1726 Acetyltransf_10 Acetyltransf_7 AAA_16 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 7154480
NCBI-ProteinID: YP_002408561
UniProt: A0A0H3MJ72
LinkDB All DBs
Structure
PDB: 

Position
complement(2710568..2712583)
Genome map
AA seq 671 aa AA seqDB search
MAELTALHTLTAQMKREGIRRLLVLSGEERWCFDHALKLRDALPGDWLWISPQPDAENHC
FPSALQTLLGREFRHAVFDARHGFDAAAFAALSGTLKAGSWLVLLLPVWEEWENQPDADS
LRWSDCPDPIATPHFVQHLKRVLTANNDAILWRQNQPFTLAHFTPRTDWHPATGAPQPEQ
QQLLQQLLTMPLGVAVVTAARGRGKSALAGQLISRIAGSAIVTAPAKAATYVLAQFAGEK
FRFIAPDALLASDEQADWLVVDEAAAIPAPLLHQLVSRFPRTLLTTTVQGYEGTGRGFLL
KFCARFPHLHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTHTPQGNIVISAFEQTLWR
SEPQTPLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAGENAIAGALWLVDEGGLSQE
LSQAVWAGFRRPRGNLVAQSLAAHGSNPLAATLCGRRVSRIAVHPARQREGTGQQLIAGA
LQYTHDLDYLSVSFGYTGELWRFWQRCGFVLVRMGNHREASSGCYTAMALLPMSDAGKQL
AEGEHYRLRRDAQALAKWNGETLPVDPLNDAVLSDDDWLELAGFAFAHRPLLTSLGCLLR
LLQTSELALPALRGRLQKNVSDAQLCTTLKLSGRKMLLVRQREEAAQALFALNDVRTERL
RDRITQWQFFH
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactgactgcgcttcacacattaacagcgcaaatgaaacgtgaagggatccgc
cgcttgctggtgttgagcggggaagagcgttggtgttttgatcatgcgcttaagttgcgt
gatgccttacctggcgactggctgtggatttcgccgcagccagatgctgaaaaccactgt
tttccctcggcgctacaaactttacttgggcgcgagttccggcatgcggtattcgacgcc
cgccacggctttgatgccgctgcctttgcggcacttagcggaacgttgaaagcgggaagc
tggctggtgttgttactccctgtatgggaagagtgggaaaaccaacctgatgccgactcg
ctgcgctggagtgattgccctgaccctattgcgacgccgcattttgtccagcatctcaaa
cgcgtacttacggcgaataacgacgctatcctctggcggcagaaccagccgttcacgttg
gcgcattttactccccgtactgactggcaccccgcgaccggcgcaccacagccagaacaa
cagcaactcttacagcagctactgaccatgccattgggcgtggcggtggtaacggctgcg
cgtgggcgcggtaaatcggcgctggcagggcaactcatttctcgtattgcgggtagtgcg
attgtcaccgcgcccgcaaaagcggcaacgtatgtactggcacaatttgcgggcgagaag
tttcgctttattgcgccggatgccttgttagccagcgatgagcaagccgactggctggtg
gtcgatgaagccgcagccatacctgcgccgttgttgcatcaactggtatcgcgttttcct
cgaacgttgttaaccactacggtgcagggctacgaaggcacgggacgtggttttttgctg
aaattttgcgctcgctttccgcatttacaccgttttgaactgcaacagccgatccgctgg
gcacagggatgcccgctggaaaaaatggttagtgaggcactggtttttgacgatgaaaac
ttcacccacacaccacaaggcaatatcgtcatttccgcatttgaacagacgttatggcga
agcgagccacaaacgccgttaaaggtttatcaattattgtctggtgcgcactaccggact
tcgccgctggatttacgccgcatgatggatgcaccagggcaacattttttacaggcggct
ggcgaaaacgcgattgccggggcgctgtggctggtggatgagggcggattatctcaagaa
ctcagtcaggcggtatgggcaggttttcgtcgcccgcggggtaatctggtggcccagtcg
ctggcggcgcacggcagcaatccactggcggcgacattgtgcggaaggcgggttagccgg
atagcagttcatccggctcgtcagcgggaaggcacaggtcagcaactgattgctggtgct
ttgcaatatacgcatgacctcgactatctttcggtgagttttggttacaccggggagtta
tggcgtttctggcaacgctgcggttttgtgctggtgcggatgggtaatcatcgtgaagcc
agcagcggttgctatacggcgatggcgctgttaccgatgagtgatgcgggtaaacaactg
gctgaaggtgagcattaccgtttacgtcgcgatgcgcaagctctcgcaaagtggaatggc
gaaacgcttcctgttgatccactaaacgatgccgtcctttctgacgacgactggcttgaa
ctggccggttttgctttcgctcatcgtccgctattaacatcgttaggttgcttattgcgt
ctgctacaaaccagtgaactggcattaccggcgctgcgtgggcgtttacagaaaaacgtc
agcgacgcgcagttatgtaccacacttaaactttcaggccgcaagatgttactggtccgt
cagcgggaagaggccgcgcaggcgctgttcgcacttaatgatgttcgcactgagcgtctg
cgcgatcgcataacgcaatggcaattttttcactga

DBGET integrated database retrieval system