KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3033Help
Entry
ECIAI39_3033      CDS       T00829                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00620  Pyruvate metabolism
ect00680  Methane metabolism
ect01100  Metabolic pathways
ect01120  Microbial metabolism in diverse environments
ect01200  Carbon metabolism
Module
ect_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECIAI39_3033 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ECIAI39_3033 (ppc)
Enzymes [BR:ect01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ECIAI39_3033 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 7150764
NCBI-ProteinID: YP_002408963
UniProt: B7NU44
LinkDB All DBs
Structure
PDB: 

Position
3152561..3155212
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGHEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtccaaatcttcacgcgctggcaatgatgctaaccgccaggagttgctcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcaattcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgtaaactgaaaaaccagccggaactgagcgaagac
accatcaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcacccaacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgtttaaaacag
ctcgataacaaagatatcgctgactacgaacacaaccagctgatgcgtcgcctgcgccag
ttgatcgcccagtcatggcatacagatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtagaaaacagcctgtggcaaggcgtaccgaattac
ctgcgcgaactgaacgaacaactggaagagaatctcggctacaaactgcccgtcgaattt
gttccggtccgttttacctcgtggatgggcggtgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctgctcagtcgctggaaagccaccgatctgttcctg
aaagatattcaggtgctggtttctgaactgtcgatggttgaagcgacccctgaactgctg
gcgctggttggcgaagagggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaaggtctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcccttcaggcgtgtggcatgggtattatcgccaatggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggtgtaccgctggtccgtattgatatccgtcaggagagcacc
cgtcataccgaagcgctgggcgaactgacccgctacctcggtatcggcgactatgaaagc
tggtcagaggccgacaaacaggcgttcctgatccgcgaactgaactccaaacgccctctt
ctgccgcgtaactggcaaccgagcgccgaaacgcgcgaagtgctcgatacctgccaggta
attgctgaagcaccgcaaggttccattgccgcctacgtgatctcgatggcaaaaacgccg
tccgacgtactggctgtacacctgctgctgaaagaagcgggtattggatttgcgatgccg
gttgcaccgctgtttgaaacccttgatgacctgaacaacgccaacgatgtcatgacccag
ttgctcaatatcgactggtatcgcggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggggtgatggcggcttcctgggcgcaatatcaggca
caggatgcattaatcaaaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgtggcggcgcacctgctcatgcggcgctgctgtcacaaccg
ccaggaagcctgaaaggtggcctgcgcgtgactgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctgtacaccggggcgattctggaa
gccaacctgctgccaccacctgagccgaaagagagctggcgtcgcattatggatgaactg
tcagtcatctcctgcgatctctaccgtggctacgtacgtgaaaacaaagattttgtgcct
tacttccgctccgctacgccggaacaagaactgggcaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcactacgcgccattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctccccgcctggctgggtgcaggaacagcgctgcaaaaa
gtggtcgaagatggtaaacagagcgagctggaggctatgtgccgcgactggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgatcaacgtctggtagacaaagcactgtggccgttaggtaaagagttacgcaat
ctgcaagaagaagacatcaaagtggtgctggcgattgccaacgattcccatctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaggccgagttgctgcaccgctcccgccaggcagaaaaagaaggccatgagccg
gatcctcgcgtcgagcaggcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system