KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3113Help
Entry
ECIAI39_3113      CDS       T00829                                 

Gene name
dtd
Definition
(RefSeq) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_3113 (dtd)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     ECIAI39_3113 (dtd)
Transfer RNA biogenesis [BR:ect03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    ECIAI39_3113 (dtd)
 Prokaryotic type
    ECIAI39_3113 (dtd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase
Motif
Other DBs
NCBI-GeneID: 7154234
NCBI-ProteinID: YP_002409042
UniProt: B7NUY4
LinkDB All DBs
Structure
PDB: 

Position
complement(3241650..3242087)
Genome map
AA seq 145 aa AA seqDB search
MIALIQRVTRASVTVEGEVTGEIGAGLLVLLGVEKDDDEQKANRLCERVLGYRIFSDVEG
KMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGASPDRAEALYDYFVERCRQQEMNT
QTGRFAADMQVSLVNDGPVTFWLQV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgattgcattaattcaacgcgtaacccgtgccagcgtcaccgtggagggagaagtgacg
ggcgaaattggcgcgggacttttggtgttattgggtgtcgaaaaggatgacgacgaacag
aaagcaaaccgtctgtgcgagcgtgtgctcggctatcgcatctttagcgatgtcgaaggc
aagatgaacctcaacgtgcaacaggcgggcggcagtgtgctggtggtttcccagtttacc
ctcgccgcagataccgaacgggggatgcgtccaagtttctccaaaggtgcatcaccggat
cgcgcagaggcgttatatgactatttcgtcgaacgctgccgtcagcaagagatgaacacg
caaacaggacgcttcgctgcggatatgcaggtatcgctggtcaatgatggccccgtgaca
ttctggttgcaggtatga

DBGET integrated database retrieval system