KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3914Help
Entry
ECIAI39_3914      CDS       T00829                                 

Gene name
asd
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00260  Glycine, serine and threonine metabolism
ect00261  Monobactam biosynthesis
ect00270  Cysteine and methionine metabolism
ect00300  Lysine biosynthesis
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01210  2-Oxocarboxylic acid metabolism
ect01230  Biosynthesis of amino acids
Module
ect_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ect_M00017  Methionine biosynthesis, apartate => homoserine => methionine
ect_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI39_3914 (asd)
   00270 Cysteine and methionine metabolism
    ECIAI39_3914 (asd)
   00300 Lysine biosynthesis
    ECIAI39_3914 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ECIAI39_3914 (asd)
Enzymes [BR:ect01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     ECIAI39_3914 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 7151513
NCBI-ProteinID: YP_002409807
UniProt: A0A0H3MVC2
LinkDB All DBs
Structure
PDB: 

Position
complement(4071294..4072397)
Genome map
AA seq 367 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTDTLQDAFDL
EALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVIT
DGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMG
HLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNP
WAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLR
RMLRQLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttggttttatcggctggcgcggtatggtcggctccgttctcatgcaacgc
atggttgaagagcgcgacttcgacgccattcgccctgtcttcttttctacttctcagctt
ggtcaggctgcgccgtcttttggcggaaccactgacacacttcaggatgcctttgatctg
gaggcgctaaaggccctcgatatcattgtgacctgtcagggcggcgattataccaacgaa
atctatccaaagcttcgtgaaagcggatggcaaggttactggattgacgcagcatcatct
ctgcgcatgaaagatgacgccatcatcattcttgaccccgtcaatcaggacgtcattacc
gacggattaaataatggcatcaggacttttgttggcggtaactgtaccgtaagcctgatg
ttgatgtcgttgggtggtttatttgccaatgatcttgttgattgggtgtccgttgcaacc
taccaggccgcttccggcggtggtgcgcgacatatgcgtgagttattaacccagatgggc
catctgtatggccatgtggcagatgaactcgcgaccccgtcctctgctattctcgatatc
gaacgcaaagtcacaaccttaacccgtagcggtgagctgccggtagataactttggcgtg
ccgctggcgggtagcctgattccgtggatcgacaaacagcttgataacggtcagagccgc
gaagagtggaaagggcaggcggaaaccaacaagatcctcaacacatcttccgtaattccg
gtagatggtttatgtgtgcgtgtcggggcattgcgctgccacagccaggcattcactatt
aaattgaaaaaagatgtgtctattccgaccgtggaagaactgctggctgcgcacaatccg
tgggcgaaagttgttccaaacgatcgggaaatcactatgcgtgagctaaccccagctgcc
gttaccggcacgctgaccacgccggtaggccgtctgcgtaagctgaatatgggaccggag
ttcctgtcagcctttaccgtgggcgaccagctgctgtggggggccgcggagccgctacgt
cggatgcttcgtcaactggcgtaa

DBGET integrated database retrieval system