KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_4345Help
Entry
ECIAI39_4345      CDS       T00829                                 

Gene name
gidA
Definition
(RefSeq) tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_4345 (gidA)
   03036 Chromosome and associated proteins [BR:ect03036]
    ECIAI39_4345 (gidA)
Transfer RNA biogenesis [BR:ect03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ECIAI39_4345 (gidA)
 Prokaryotic type
    ECIAI39_4345 (gidA)
Chromosome and associated proteins [BR:ect03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ECIAI39_4345 (gidA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA GIDA_assoc FAD_binding_2 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C HI0933_like DAO Thi4 Pyr_redox MarR_2 FAD_binding_3 Pyr_redox_3 NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 7151504
NCBI-ProteinID: YP_002410220
UniProt: B7NR43
LinkDB All DBs
Structure
PDB: 

Position
complement(4527214..4529103)
Genome map
AA seq 629 aa AA seqDB search
MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMI
FQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPS
IPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQV
PCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPE
GLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESK
FIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTL
GTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQRL
KSTWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTPFAPALTDEQAAE
QVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQ
ASRISGVTPAAISILLVWLKKQGMLRRSA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttttatccggatccttttgacgtcatcatcattggcgggggtcatgcaggcaccgag
gccgcgatggccgcggcgcgtatgggtcaacagactctgcttttgacacacaatatcgac
actctggggcagatgagctgcaacccggcgatcggcggtattgggaagggacatctggta
aaagaagtggatgcactcggcggtctgatggcgaaagcgatcgatcaggcgggtatccag
tttaggatactaaacgcaagcaagggaccggcggttcgcgctacccgagctcaggcagat
cgtgtgctctaccgtcaggcggtacgtacggcgctggagaaccaaccgaacctgatgatc
ttccagcaggcagttgaagatcttattgtcgaaaatgatcgcgtggtcggagccgttacc
caaatgggactgaagttccgtgccaaagctgtcgtgctcactgttgggacgttcctcgac
ggtaaaattcatatcggtctggataactacagcggtggccgtgctggtgatccgccgtcc
attccgctttctcgccgtttgcgtgaactgccgctgcgcgttggtcgtctgaaaaccggg
acaccaccgcgtattgatgctcgaaccatcgactttagcgtactggcgcaacagcatggc
gataacccaatgccggtattctcgtttatgggcaatgcgtcccagcatccccagcaggtg
ccgtgttatatcactcataccaacgagaaaacccatgatgtgatccgcagtaacctcgat
cgtagcccaatgtacgcaggggtgatcgaaggtgtcggcccacgctactgcccgtcgatc
gaagacaaagtcatgcgcttcgccgacagaaatcagcatcagatcttccttgaaccggaa
gggctgacctctaacgaaatttatccgaacggtatctccaccagcctgccgttcgatgtg
cagatgcaaatcgtccgctccatgcaggggatggaaaacgcgaagatcgtgcgtccgggt
tatgccattgagtatgacttcttcgatccacgcgacctgaaaccgacgctggagagcaag
tttatccaggggctgttctttgctggtcagattaacggcactaccggttacgaagaagcc
gctgcgcaaggtttgctggctggtcttaacgctgcccgtctgtctgcagacaaagaaggt
tgggctccggcgcgttctcaggcgtatctcggcgtactggttgatgacctgtgcacttta
ggaaccaaagaaccgtatcgtatgtttacctcgcgcgcagaatatcgtctgatgctgcgc
gaagataatgcggatctgcgtttgactgaaatcggtcgtgaactgggcctggtggatgac
gaacgttgggcgcgctttaacgagaaacttgagaatatcgagcgtgagcgtcagcgtctg
aaatcgacctgggtaaccccgtcggcggaagctgcagccgaagtgaatgctcacctgact
gcgccactttcccgtgaagccagtggtgaagatctgctgcgtcgtccggaaatgacttat
gaaaaattaaccacgctgacgccgtttgcccctgcgttgacagacgaacaggcggcggaa
caggttgagattcaggttaaatacgaaggttatatcgcgcgccagcaagatgagatcgaa
aagcagctgcgtaacgagaacaccctgctaccagcgacgctggattaccgccaggtatcc
ggtctttctaacgaagtgatcgccaaacttaacgatcacaaaccggcctctatcggtcag
gcttcgcgtatttctggcgtcacgcctgcggccatctccattctgctggtgtggctgaaa
aaacagggtatgctgcgtcgtagcgcataa

DBGET integrated database retrieval system