KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_4644Help
Entry
ECIAI39_4644      CDS       T00829                                 

Gene name
rnr
Definition
(RefSeq) exoribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ect00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ECIAI39_4644 (rnr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ect03019]
    ECIAI39_4644 (rnr)
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_4644 (rnr)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     ECIAI39_4644 (rnr)
Messenger RNA biogenesis [BR:ect03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     ECIAI39_4644 (rnr)
Transfer RNA biogenesis [BR:ect03016]
 Prokaryotic type
  tRNA degradation factors
   ECIAI39_4644 (rnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB CSD2 S1 HTH_12 RNase_II_C_S1 RNA_pol_Rbc25 OB_Dis3 Rho_RNA_bind MetOD2 Sucrose_synth
Motif
Other DBs
NCBI-GeneID: 7152260
NCBI-ProteinID: YP_002410505
UniProt: A0A0H3MNG8
LinkDB All DBs
Structure
PDB: 

Position
4846120..4848561
Genome map
AA seq 813 aa AA seqDB search
MSQDPFQEREAEKYANPIPSREFILEHLTKREKPASRDELAVELHIEGEEQLEGLRRRLR
AMERDGQLVFTRRQCYALPERLDLVKGTVIGHRDGYGFLRVEGRKDDLYLSSEQMKTCIH
GDQVLAQPLGADRKGRREARIVRVLVPKTSQIVGRYFTEAGVGFVVPDDSRLSFDILIPP
DQIMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGMAVDIALRTHEIPYIWPQA
VEQQVAGLKEEVPEEAKAGRVDLRDLPLLTIDGEDARDFDDAVYCEKKRGGGWRLWVAIA
DVSYYVRPPTPLDREARNRGTSVYFPSQVIPMLPEVLSNGLCSLNPQVDRLCMVCEMTVS
SKGRLTGYKFYEAVMSSHARLTYTKVWHILQGDQDLREQYAPLVKHLEELHNLYKVLDKA
REERGGISFESEEAKFIFNAERRIERIEQTQRNDAHKLIEECMILANISAARFVEKAKEP
ALFRIHDKPSTEAITSFRSVLAELGLELPGGNKPEPRDYAELLESVADRPDAEMLQTMLL
RSMKQAIYDPENRGHFGLALQSYAHFTSPIRRYPDLTLHRAIKYLLAKEQGHQGNTTETG
GYHYSMEEMLQLGQHCSMAERRADEATRDVADWLKCDFMLDQVGNVFKGVISSVTGFGFF
VRLDDLFIDGLVHVSSLDNDYYRFDQVGQRLMGESSGQTYRLGDRVEVRVEAVNMDERKI
DFSLISSERAPRNVGKTAREKAKKGDAGKKGGKRRQVGKKVNFEPDSAFRGEKKPKPKAA
KKDARKAKKPSAKTQKIAAATKAKRAAKKKVAE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagatcctttccaggaacgcgaagctgaaaaatacgcgaatcccatccctagt
cgggaatttatcctcgaacatttaaccaaacgtgaaaaaccggccagccgtgatgagctg
gcggtagaactgcacattgaaggcgaagagcagcttgaaggcctgcgtcgccgcctgcgc
gcgatggagcgcgatggtcaactggtcttcactcgtcgtcagtgctatgcgctgccggaa
cgcctcgacctggtgaaaggtaccgttattggccaccgtgatggctacggctttctgcgg
gttgaagggcgtaaagatgatttgtatctctccagcgagcagatgaaaacctgcattcat
ggcgatcaggtgctggcgcagccgctgggcgctgaccgtaaaggtcgtcgtgaagcgcgt
attgtccgcgtactggtgccaaaaaccagccagattgttggtcgctattttaccgaagcg
ggcgtcggctttgtggttcctgacgacagtcgtttgagcttcgatatcttaatcccgccc
gatcagatcatgggcgcgcggatgggctttgtggtggtggttgaactgacccaacgcccg
actcgccgtaccaaagcggtgggtaaaatcgtcgaagtacttggcgacaatatgggcacc
ggcatggcggttgatattgctctgcgtacccatgaaattccgtacatctggccgcaggct
gttgagcaacaggttgccgggctgaaagaagaagtgccggaagaagcaaaagcgggccgt
gtcgatctgcgcgatttaccgctgctcaccattgatggcgaagacgcccgtgactttgac
gatgcagtttactgtgagaaaaaacgcggcggcggctggcgtttatgggtcgcgattgcc
gacgtcagctactatgtgcgtccgccaacaccgctggacagagaagcgcgtaaccgtggt
acgtcggtgtacttcccttcgcaggttatcccgatgctgccggaagtgctctctaacggc
ctgtgttcgctcaacccgcaggtagaccgcctgtgtatggtgtgcgagatgacggtttcg
tcgaaaggccgcctgactggctacaaattctacgaagcggtgatgagctctcacgcgcgt
ctgacctacaccaaagtctggcatattctgcagggcgatcaggatctgcgcgagcagtac
gccccgctggttaagcatctcgaagagttgcataacctctataaagtgctggataaagcc
cgtgaagaacgcggagggatctcatttgagagcgaagaagcgaagttcattttcaacgct
gaacgccgtattgaacgtatcgaacagactcagcgtaacgacgcccacaagttaattgaa
gagtgcatgattctggcgaatatctcggcggcgcgtttcgttgagaaagcgaaagaaccg
gcactgttccgtattcacgacaagccgagcaccgaagcaattacctctttccgttcagtg
ctggcggagctggggctggaattgccgggcggtaacaagccggaaccgcgtgactacgcg
gagctgctagagtcggttgccgatcgtcctgacgcagaaatgctgcaaaccatgctgctg
cgctcgatgaaacaggcgatttacgatccggaaaaccgtggtcacttcggtctggcattg
cagtcctatgcgcactttacttcgccgattcgtcgttatcctgacctgacgctgcaccgc
gccattaaatatctgctggcgaaagagcaggggcatcagggcaacaccactgaaaccggc
ggctaccattattcgatggaagagatgctgcaactgggtcagcactgttcgatggcggaa
cgtcgtgccgacgaagcaacacgcgatgtagctgactggctgaagtgtgacttcatgctc
gaccaggtaggtaacgtctttaaaggcgtaatttccagcgtcactggctttggcttcttc
gtccgtctggacgacttgttcattgatggtctggtccatgtctcttcgctggacaatgac
tactatcgctttgaccaggtagggcaacgcctgatgggtgaatccagcggccagacttat
cgcctgggcgatcgcgtggaagttcgcgttgaagcggttaatatggacgagcgcaaaatc
gactttagcctgatctccagcgaacgcgcaccgcgcaacgtcggtaaaacggcgcgcgag
aaagcgaaaaaaggcgatgcaggcaaaaaaggcggcaagcgtcgtcaggtcggtaaaaag
gtaaactttgagccagacagcgccttccgcggcgagaaaaaaccgaagccgaaagcggcg
aagaaagacgcgagaaaagcgaaaaagccatcggcgaaaacgcagaaaatagccgcagcg
accaaagcgaagcgtgcggcgaagaaaaaagtggcagagtga

DBGET integrated database retrieval system