KEGG   Escherichia coli APEC O1 (APEC): APECO1_1443Help
Entry
APECO1_1443       CDS       T00425                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APECO1_1443 (ahpF)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     APECO1_1443 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABJ00027
UniProt: A0A0H2YWI9
LinkDB All DBs
Structure
PDB: 

Position
625105..626700
Genome map
AA seq 531 aa AA seqDB search
MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
SKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaaagcccaggagataaacatgctcgacacaaatatgaaaactcaactc
aaggcttaccttgagaaattgaccaagcctgttgagttaattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgttggctgaaatcgcagaactgtcagacaaagtc
acctttaaagaagataacagcttgccggtgcgtaagccgtctttcctgatcaccaaccca
ggttccaaccagggaccacgttttgcaggctccccgctgggccacgagttcacctcgctg
gtactggcgttgctgtggaccggtggtcatccgtcgaaagaagcgcagtctctgctggag
cagattcgccatattgacggtgattttgaattcgaaacctattactcgctctcttgccac
aactgcccggacgtggtgcaggcgctgaacctgatgagtgtactgaacccgcgcatcaag
cacactgcaattgacggcggcaccttccagaacgaaatcaccgatcgcaacgtgatgggc
gttccggcagtgttcgtaaacgggaaagagtttggtcagggccgcatgacgttgactgaa
atcgttgccaaaattgatactggtgcggaaaaacgtgcggcagaagagctgaataagcgt
gatgcttatgacgtattaatcgttggttccggaccggcgggtgcagcggcagcaatttac
tccgcacgtaaaggcatccgtaccggtctgatgggcgaacgttttggtggtcagatcctc
gataccgttgatatcgaaaactacatttctgtaccgaagaccgaaggccagaaactggca
ggtgcgctgaaagttcatgttgatgaatacgacgttgatgtgatcgatagccagagcgcg
agcaaactgatcccggcagcggttgaaggcggcctgcatcagattgaaacagcttctggc
gcggtactgaaagcacgcagcattatcgtggcgactggtgcaaaatggcgcaacatgaac
gttcctggcgaagatcagtatcgcaccaaaggcgtgacctactgcccgcactgcgacggc
ccgctgtttaaaggcaaacgcgtagcggttatcggcggcggtaactccggcgtggaagcg
gcaattgacctggcgggtatcgttgagcacgtaacgctgctggaatttgcgccagaaatg
aaagccgaccaggttctgcaggacaaactgcgcagcctgaaaaacgtcgacattattctg
aatgcgcaaaccacggaagtgaaaggcgacggtagcaaagtcgtaggtctggaatatcgc
gatcgtgtcagcggcgatattcacaacatcgaactggccggtattttcgtccagattggt
ctgctgccgaacaccaactggctggaaggcgcagtcgaacgtaatcgcatgggcgagatt
atcattgatgcgaaatgcgaaaccaacgtcaaaggcgtgttcgcagcgggtgactgtacg
acggttccgtacaagcagatcatcatcgccactggcgaaggtgccaaagcctctctgagt
gcttttgactacctgattcgcaccaaaactgcataa

DBGET integrated database retrieval system