KEGG   Escherichia coli APEC O1 (APEC): APECO1_2511Help
Entry
APECO1_2511       CDS       T00425                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00620  Pyruvate metabolism
ecv00680  Methane metabolism
ecv01100  Metabolic pathways
ecv01120  Microbial metabolism in diverse environments
ecv01200  Carbon metabolism
Module
ecv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APECO1_2511 (ppc)
  Energy metabolism
   00680 Methane metabolism
    APECO1_2511 (ppc)
Enzymes [BR:ecv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APECO1_2511 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABJ03424
UniProt: A1AID4
LinkDB All DBs
Structure
PDB: 

Position
complement(4466790..4469441)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDVYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQNELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGQEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtccaaatcttcacgcgctggcaatgatgctaaccgccaggagttgctcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcagtttctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgcaaactgaaaaaccagccggaactgagcgaagac
accataaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcacccaacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgcttaaaacag
ctcgataacaaagatatcgccgactacgaacataaccagctgatgcgccgcctgcgccag
ttgatcgcccagtcatggcatacagatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtagaaaacagcctgtggcaaggcgtaccgaattac
ctgcgcgaactgaacgaacaactggaagagaatctcggctacaaactgcccgtcgaattt
gttccggtccgttttacctcgtggatgggcggtgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctgctcagtcgctggaaagccaccgatctgttcctg
aaagatattcaggtgctggtttctgaactgtcgatggttgaagcgacccctgaactgctg
gcgctggttggcgaagaaggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaaggcctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcacttcaggcgtgtggcatgggtattatcgccaacggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggcgtaccgctggtgcgtattgatatccgtcaggagagcacc
cgccataccgaagcgctgggcgagctgacccgctacctcggtatcggcgactacgagagc
tggtcagaagccgacaaacaggcgttcctgatccgcgaactgaactccaaacgtccgctt
ctaccgcgcaactggcaaccaagcgccgaaacgcgcgaagtgctcgatacctgccaggtg
attgccgaagcgccgcaaggctccattgccgcctacgtgatctcgatggcgaaaacgccg
tccgacgtgctggctgtccacctgctgctgaaagaagcgggtatcgggtttgcgatgccg
gttgctccgctgtttgaaaccctcgatgacctgaacaacgccaacgatgtcatgacccag
ctgctgaatatcgactggtatcgcggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggcgtgatggcagcttcctgggcgcaatatcaggca
caggatgcattaatcaaaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgcggcggcgcacctgcccatgcggcgctgctgtcacaaccg
ccaggaagcctgaaaggtggcctgcgcgtgaccgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctgtacaccggggcgattctggaa
gccaacctgctgccaccgcctgagccgaaagagagctggcgtcgtattatggatgaactg
tctgttatctcctgcgatgtctaccgcggctacgtacgtgaaaacaaagattttgtgcct
tacttccgctccgctacgccggaacaagaattgggtaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcactgcgcgctattccgtggattttcgcc
tggacgcaaaaccgcctgatgctccccgcctggctgggtgcaggtacggcgctgcaaaaa
gtggtcgaagatggcaaacagaacgagctggaagccatgtgccgcgattggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgaccaacgcctggtagacaaagcactgtggccgttaggtaaagagttacgcaat
ctgcaagaagaagacatcaaagtggtgctggcgattgccaacgattctcacctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaggccgagttgctgcaccgctcccgccaggcagaaaaagaaggccaggaaccg
gatcctcgcgtcgagcaggcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system