KEGG   Escherichia coli APEC O1 (APEC): APECO1_2931Help
Entry
APECO1_2931       CDS       T00425                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase B, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00250  Alanine, aspartate and glutamate metabolism
ecv00410  beta-Alanine metabolism
ecv00430  Taurine and hypotaurine metabolism
ecv00650  Butanoate metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv02024  Quorum sensing
Module
ecv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    APECO1_2931 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APECO1_2931 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APECO1_2931 (gadB)
   00430 Taurine and hypotaurine metabolism
    APECO1_2931 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    APECO1_2931 (gadB)
Enzymes [BR:ecv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     APECO1_2931 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABJ02999
UniProt: A0A0H2Z472
LinkDB All DBs
Structure
PDB: 

Position
complement(3965752..3967182)
Genome map
AA seq 476 aa AA seqDB search
MXSNXFKEFXMDXKXXTDXXSELLDSRFGAKXISTIAESKRFPLHEMRDDVAFQIINDEL
YLDGNARQNLATFCQTWDDXNVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHA
PAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNLVCGPVQICWHKFA
RYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKF
QADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWR
DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVA
AYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFT
LGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
wtgcswtcmaatmawtttaaggagttyraaatggaymagaagcwrktaacggatttmmgs
tcrgaactactcgattcacgttttggygcraagkcyatttcyactatcgcagaatcaaaa
cgwtttccgctgcacgaaatgcgygatgatgtygcattycagattatcaatgatgaatta
tatcttgatggcaacgctcgtcagaacctggccactttctgccagacctgggacgacgaw
aaygtccataarttgatggatttrtcsatyaayaaaaactggatcgacaaagaagaatat
ccgcaatcygcwgcaatcgayctgcgttgcgtaaacatggttgccgatctgtggcatgcg
cctgcaccgaaaaatggtcaggccgttggcaccaacaccattggttcttccgaggcctgt
atgctcggcgggatggcgatgaaatggcgttggcgcaagcgtatggaagctgcaggtaag
ccgactaacaaaccgaacctggtgtgcggtccggtacaaatctgctggcataaattcgcc
cgctactgggatgtggagttgcgtgagatccctatgcgccccggtcagttgtttatggac
ccgaaacgcatgattgaagcctgcgacgaaaacaccatcggcgtggtgccgactttcggc
gtgacctacaccggtaactatgagttcccgcagccgctgcacgatgcgctggataaattc
caggccgacaccggtatcgacatcgacatgcacatcgacgccgccagcggtggcttcctg
gcaccgttcgtcgccccggatatcgtctgggacttccgcctgccgcgtgtgaaatcgatc
agtgcttcaggccataaattcggtctggctccgctgggctgcggctgggttatctggcgt
gatgaagaagcgctgccgcaggaactggtgttcaacgttgactacctcggcggtcagatt
ggtactttcgccatcaacttctcccgcccggcgggtcaggtgattgcacagtactatgaa
ttcctgcgcctcggtcgtgaaggctataccaaagtacagaacgcttcctaccaggttgct
gcttatctggcggatgaaatcgccaaactggggccgtatgagttcatctgtacsggtcgc
ccggacgaaggcatcccggcggtttgcttcaaactgaaagatggtgaagatccgggatac
accctgtatgacctctctgaacgtctgcgtctgcgcggctggcaggttccggccttcact
ctcggcggtgaagccaccgacatcgtggtgatgcgcattatgtgtcgtcgcggcttcgaa
atggactttgctgaactgttgctggaagactacaaagcctccctgaaatatctcagcgac
cacccgaaactgcagggtattgcccagcagaacagctttaaacacacctga

DBGET integrated database retrieval system