KEGG   Escherichia coli APEC O1 (APEC): APECO1_3114Help
Entry
APECO1_3114       CDS       T00425                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ecv03012]
    APECO1_3114 (tufA)
   03029 Mitochondrial biogenesis [BR:ecv03029]
    APECO1_3114 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecv04147]
    APECO1_3114 (tufA)
Translation factors [BR:ecv03012]
 Eukaryotic Type
  Elongation factors
   APECO1_3114 (tufA)
 Prokaryotic Type
   APECO1_3114 (tufA)
Mitochondrial biogenesis [BR:ecv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    APECO1_3114 (tufA)
Exosome [BR:ecv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   APECO1_3114 (tufA)
  Exosomal proteins of breast cancer cells
   APECO1_3114 (tufA)
  Exosomal proteins of colorectal cancer cells
   APECO1_3114 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ABJ02816
UniProt: A1AGM6
LinkDB All DBs
Structure
PDB: 

Position
complement(3760928..3762157)
Genome map
AA seq 409 aa AA seqDB search
MLSPEGESTIVRNIAVSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAAR
AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILV
VAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPG
DDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRG
TVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKRE
EIERGQVLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELP
EGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgctctctcctgaaggggagagcactatagtaaggaatatagccgtgtctaaagaaaaa
tttgaacgtacaaaaccgcacgttaacgttggtactatcggccacgttgaccacggtaaa
actactctgaccgctgcaatcaccaccgtactggctaaaacctacggcggtgctgctcgt
gcattcgaccagatcgataacgcgccggaagaaaaagctcgtggtatcaccatcaacact
tctcacgttgaatacgacaccccgacccgtcactacgcgcacgtagactgcccggggcac
gccgactatgttaaaaacatgatcaccggtgctgctcagatggacggcgcgatcctggta
gttgctgcgactgacggcccgatgccgcagactcgtgagcacatcctgctgggtcgtcag
gtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatggttgatgacgaagag
ctgctggaactggttgaaatggaagttcgtgaacttctgtctcagtacgacttcccgggc
gacgacactccgatcgttcgtggttctgctctgaaagcgctggaaggcgacgcagagtgg
gaagcgaaaatcctggaactggctggcttcctggattcctacattccggaaccagagcgt
gcgattgacaagccgttcctgctgccgatcgaagacgtattctccatctccggtcgtggt
accgttgttaccggtcgtgtagaacgcggtatcatcaaagttggtgaagaagttgaaatc
gttggtatcaaagagactcagaagtctacctgtactggcgttgaaatgttccgcaaactg
ctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgcggtatcaaacgtgaa
gaaatcgaacgtggtcaggtactggctaagccgggcaccatcaagccgcacaccaagttc
gaatctgaagtgtacattctgtccaaagatgaaggcggtcgtcatactccgttcttcaaa
ggctaccgtccgcagttctacttccgtactactgacgtgactggtaccatcgaactgccg
gaaggcgtagagatggtaatgccgggcgacaacatcaaaatggttgttaccctgatccac
ccgatcgcgatggacgatggtctgcgtttcgcaatccgtgaaggcggccgtaccgttggc
gcgggcgttgttgctaaagttctgggctaa

DBGET integrated database retrieval system