KEGG   Escherichia coli APEC O1 (APEC): APECO1_352Help
Entry
APECO1_352        CDS       T00425                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase/deoxyuridine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00240  Pyrimidine metabolism
ecv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    APECO1_352 (tdk)
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     APECO1_352 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: ABJ00652
UniProt: A0A0H2YY59
LinkDB All DBs
Position
1306848..1307465
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEVGSLTAIQERHRHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagttcgcgtataggtttgtcatcacctgcaaaa
ttatttaaccaaaattcatcattatttgatgagattcgtgcggaacatgaacagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtcgatcaactcgatatacccgtactttgttatggtttacgtaccgatttt
cgaggtgaattatttattggcagtcaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggtgagcaggtggttattggtggtaatgaacgctacgtttct
gtatgccgtaaacactataaagaagcgttagaagtcggctcattaacggctattcaggaa
aggcatcgccacgattaa

DBGET integrated database retrieval system